Species : |
Human |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
22-195aa |
Description : |
The protein encoded by this gene is an interferon and possesses antiviral activity. The encoded protein binds to the interferon alpha/beta receptor but not to the interferon gamma receptor. This intronless gene has several pseudogenes spread throughout the genome. |
Form : |
Liquid |
Bio-activity : |
Measured in a cytotoxicity assay using TF-1 human erythroleukemic cells. The ED50 range ≤0.07 ng/mL. |
Molecular Mass : |
20.9 kDa (180aa) |
AA Sequence : |
LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS< HHHHHH> |
Endotoxin : |
< 1.0 EU/μg of the protein by the LAL method. |
Purity : |
> 95% by SDS-PAGE |
Applications : |
SDS-PAGE, Bioactivity |
Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : |
1 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |