Active Recombinant Human IFNW1 Protein (22-195aa), C-His tagged
Cat.No. : | IFNW1-01H |
Product Overview : | Recombinant human IFN-omega (22-195aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-195aa |
Description : | The protein encoded by this gene is an interferon and possesses antiviral activity. The encoded protein binds to the interferon alpha/beta receptor but not to the interferon gamma receptor. This intronless gene has several pseudogenes spread throughout the genome. |
Form : | Liquid |
Bio-activity : | Measured in a cytotoxicity assay using TF-1 human erythroleukemic cells. The ED50 range ≤0.07 ng/mL. |
Molecular Mass : | 20.9 kDa (180aa) |
AA Sequence : | LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS< HHHHHH> |
Endotoxin : | < 1.0 EU/μg of the protein by the LAL method. |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | IFNW1 interferon, omega 1 [ Homo sapiens (human) ] |
Official Symbol | IFNW1 |
Synonyms | IFNW1; interferon, omega 1; interferon omega-1; IFN omega 1; interferon omega 1; interferon alpha-II-1; IFN-omega 1, interferon omega-1; |
Gene ID | 3467 |
mRNA Refseq | NM_002177 |
Protein Refseq | NP_002168 |
MIM | 147553 |
UniProt ID | P05000 |
◆ Recombinant Proteins | ||
IFNW1-157H | Active Recombinant Human IFNW1 Protein (Cys24-Ser195), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IFNW1-3103H | Recombinant Human IFNW1 Protein (Leu22-Ser195), C-His tagged | +Inquiry |
IFNW1-27988TH | Recombinant Human IFNW1 | +Inquiry |
IFNW1-534H | Recombinant Human IFNW1 protein | +Inquiry |
IFNW1-01H | Active Recombinant Human IFNW1 Protein (22-195aa), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNW1-1382HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
IFNW1-2929HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNW1 Products
Required fields are marked with *
My Review for All IFNW1 Products
Required fields are marked with *