Active Recombinant Human IFNW1 Protein (22-195aa), C-His tagged
| Cat.No. : | IFNW1-01H |
| Product Overview : | Recombinant human IFN-omega (22-195aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 22-195aa |
| Description : | The protein encoded by this gene is an interferon and possesses antiviral activity. The encoded protein binds to the interferon alpha/beta receptor but not to the interferon gamma receptor. This intronless gene has several pseudogenes spread throughout the genome. |
| Form : | Liquid |
| Bio-activity : | Measured in a cytotoxicity assay using TF-1 human erythroleukemic cells. The ED50 range ≤0.07 ng/mL. |
| Molecular Mass : | 20.9 kDa (180aa) |
| AA Sequence : | LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS< HHHHHH> |
| Endotoxin : | < 1.0 EU/μg of the protein by the LAL method. |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | IFNW1 interferon, omega 1 [ Homo sapiens (human) ] |
| Official Symbol | IFNW1 |
| Synonyms | IFNW1; interferon, omega 1; interferon omega-1; IFN omega 1; interferon omega 1; interferon alpha-II-1; IFN-omega 1, interferon omega-1; |
| Gene ID | 3467 |
| mRNA Refseq | NM_002177 |
| Protein Refseq | NP_002168 |
| MIM | 147553 |
| UniProt ID | P05000 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNW1 Products
Required fields are marked with *
My Review for All IFNW1 Products
Required fields are marked with *



