Active Recombinant Human IGFBP-1 Protein (26-259aa)

Cat.No. : IGFBP1-03H
Product Overview : Recombinant human IGFBP1 (26-259aa) without tag was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability August 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Protein Length : 26-259aa
Description : This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients.
Form : Liquid
Bio-activity : Measured by its ability to inhibit proliferation using MCF-7 human breast cancer cells in the presence of Human IGF-1. The ED50 range ≤3 μg/mL.
Molecular Mass : 25.2 kDa (234aa)
AA Sequence : APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name IGFBP1 insulin like growth factor binding protein 1 [ Homo sapiens (human) ]
Official Symbol IGFBP1
Synonyms IGFBP1; insulin like growth factor binding protein 1; AFBP; IBP1; PP12; IGF-BP25; hIGFBP-1; insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1; alpha-pregnancy-associated endometrial globulin; amniotic fluid binding protein; binding protein-25; binding protein-26; binding protein-28; growth hormone independent-binding protein; placental protein 12
Gene ID 3484
mRNA Refseq NM_000596
Protein Refseq NP_000587
MIM 146730
UniProt ID P08833

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFBP1 Products

Required fields are marked with *

My Review for All IGFBP1 Products

Required fields are marked with *

0
cart-icon