Active Recombinant Human IL11 Protein

Name: Active Recombinant Human IL11 Protein
SKU: IL11-259I

Specification
Gene Information
Related Products
Download

Species :	Human
Source :	CHO
Description :	Interleukin-11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 has multiple effects on both hematopoietic and non-hematopoietic cells. Many of the biological effects described for IL-11 overlap with those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell-dependent development of specific immunoglobulin-secreting B cells.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 5 ng/mL, measured in a proliferation assay using T11 cells.
Molecular Mass :	~23 kDa, observed by reducing SDS-PAGE.
AA Sequence :	PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE and HPLC.
Storage :	Lyophilized recombinant Human Interleukin-11 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-11 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	IL11 interleukin 11 [ Homo sapiens ]
Official Symbol	IL11
Synonyms	IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11;
Gene ID	3589
mRNA Refseq	NM_000641
Protein Refseq	NP_000632
MIM	147681
UniProt ID	P20809