Species : |
Human |
Source : |
CHO |
Description : |
Interleukin-11 is a pleiotropic cytokine that was originally detected in the conditioned medium of an IL-1α-stimulated primate bone marrow stromal cell line (PU-34) as a mitogen for the IL-6-responsive mouse plasmacytoma cell line T11. IL-11 has multiple effects on both hematopoietic and non-hematopoietic cells. Many of the biological effects described for IL-11 overlap with those for IL-6. In vitro, IL-11 can synergize with IL-3, IL-4 and SCF to shorten the G0 period of early hematopoietic progenitors. IL-11 also enhances the IL-3-dependent megakaryocyte colony formation. IL-11 has been found to stimulate the T cell-dependent development of specific immunoglobulin-secreting B cells. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 5 ng/mL, measured in a proliferation assay using T11 cells. |
Molecular Mass : |
~23 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
Storage : |
Lyophilized recombinant Human Interleukin-11 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-11 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |