Species : |
Human |
Source : |
Nicotiana Benthamiana |
Tag : |
Non |
Protein Length : |
123 a.a. |
Description : |
Activins are homodimers or heterodimers of the various beta subunit isoforms, belonging to the TGF-beta family. Mature Activin B has two chains of 123 amino acids residues (betaB-betaB). Activin exhibits a wide range of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins plays a key role in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Inhibins/Activins are protein that are formed by the dimerization of two subunits, i. e. an α (alpha) with either beta A (betaA) - Inhibin A or beta B (betaB) - Inhibin B. The subunits betaA and betaB can also form homodimers or heterodimers called Activin: Activin A (betaA -betaA), Activin B (betaB -betaB) and Activin AB (betaA -betaB). The Activin gene family comprises the additional, but poorly characterized members" Activin betaC (betaC), beta D (betaD) and beta E (betaE). As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B. |
Form : |
Lyophilized from Tris HCl 0.05M buffer at pH 7.4. |
Bio-activity : |
The biological activity of Activin B is measured by its ability to inhibit mouse plasmacytoma cell line (MPC-11) cells proliferation. EC50< 5="" ng/ml="" are="" required="" to="" stimulate="" a="" half-maximal="" response="" at="" cytokine="" saturation.="" note:="" since="" applications="" vary,="" each="" investigator="" should="" titrate="" the="" reagent="" to="" obtain="" optimal=""> |
Molecular Mass : |
Recombinant human Activin B is a 14 KDa betaB single chain, containing 123 amino residues. |
AA Sequence : |
HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQ YRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG |
Endotoxin : |
< 0.04="" eu="" ug="" protein="" (lal=""> |
Purity : |
>97% by SDS-PAGE gel |
Applications : |
Cell culture, Western blot |
Storage : |
This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C and it is recommended to add a carrier protein (0.1% HSA or BSA). Repeated freezing and thawing is not recommended. |
Reconstitution : |
Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Due to the protein nature, dimmers and multimers may be observed. Upon reconstitution, It can be stored in working aliquots at –20°C for future use. Optimal reconstitution please follow batch Quality Control sheet instructions. |