Active Recombinant Human INHBB, Animal Free
Cat.No. : | INHBB-139H |
Product Overview : | Recombinant human Activin B is a 14 KDa betaB single chain, containing 123 amino residues. Human recombinant protein expressed in Nicotiana benthamiana. Recombinant human Activin B contains a 10-His-tag at the N-terminal end, is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. Animal free product. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | Non |
Protein Length : | 123 a.a. |
Description : | Activins are homodimers or heterodimers of the various beta subunit isoforms, belonging to the TGF-beta family. Mature Activin B has two chains of 123 amino acids residues (betaB-betaB). Activin exhibits a wide range of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins plays a key role in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Inhibins/Activins are protein that are formed by the dimerization of two subunits, i. e. an α (alpha) with either beta A (betaA) - Inhibin A or beta B (betaB) - Inhibin B. The subunits betaA and betaB can also form homodimers or heterodimers called Activin: Activin A (betaA -betaA), Activin B (betaB -betaB) and Activin AB (betaA -betaB). The Activin gene family comprises the additional, but poorly characterized members" Activin betaC (betaC), beta D (betaD) and beta E (betaE). As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B. |
Form : | Lyophilized from Tris HCl 0.05M buffer at pH 7.4. |
Bio-activity : | The biological activity of Activin B is measured by its ability to inhibit mouse plasmacytoma cell line (MPC-11) cells proliferation. EC50< 5="" ng/ml="" are="" required="" to="" stimulate="" a="" half-maximal="" response="" at="" cytokine="" saturation.="" note:="" since="" applications="" vary,="" each="" investigator="" should="" titrate="" the="" reagent="" to="" obtain="" optimal=""> |
Molecular Mass : | Recombinant human Activin B is a 14 KDa betaB single chain, containing 123 amino residues. |
AA Sequence : | HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQ YRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECG |
Endotoxin : | < 0.04="" eu="" ug="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Applications : | Cell culture, Western blot |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C and it is recommended to add a carrier protein (0.1% HSA or BSA). Repeated freezing and thawing is not recommended. |
Reconstitution : | Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Due to the protein nature, dimmers and multimers may be observed. Upon reconstitution, It can be stored in working aliquots at –20°C for future use. Optimal reconstitution please follow batch Quality Control sheet instructions. |
Gene Name | INHBB inhibin, beta B [ Homo sapiens ] |
Official Symbol | INHBB |
Synonyms | INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939; |
Gene ID | 3625 |
mRNA Refseq | NM_002193 |
Protein Refseq | NP_002184 |
MIM | 147390 |
UniProt ID | P09529 |
Chromosome Location | 2cen-q13 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; hormone activity; host cell surface receptor binding; protein binding; protein homodimerization activity; |
◆ Recombinant Proteins | ||
INHBB-1764H | Recombinant Human INHBB protein, His & GST-tagged | +Inquiry |
INHBB-1762C | Recombinant Chicken INHBB protein, His-tagged | +Inquiry |
INHBB-3066R | Recombinant Rat INHBB Protein | +Inquiry |
Inhbb-1765M | Recombinant Mouse Inhbb protein, His-tagged | +Inquiry |
INHBB-8214M | Recombinant Mouse INHBB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBB-2612HCL | Recombinant Human INHBB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBB Products
Required fields are marked with *
My Review for All INHBB Products
Required fields are marked with *
0
Inquiry Basket