Active Recombinant Human LDHA Protein, His-tagged

Cat.No. : LDHA-29849TH
Product Overview : Recombinant human LDHA (1-332aa) protein with His tag was expressed in E.coli (Bioactivity Validated).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-332 a.a.
Description : LDHA, also known as L-lactate dehydrogenase A chain, is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. This protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in LDHA have been linked to exertional myoglobinuria.
Form : Liquid
Bio-activity : Specific activity is > 300 units/mg, in which one unit will convert 1.0 umole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37C.
Molecular Mass : 38.8 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Purity : > 95% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL(determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl
Gene Name LDHA
Official Symbol LDHA lactate dehydrogenase A [ Homo sapiens (human) ]
Synonyms LDHA; lactate dehydrogenase A; LDHM; GSD11; PIG19; HEL-S-133P; L-lactate dehydrogenase A chain; LDH muscle subunit; LDH-A; LDH-M; cell proliferation-inducing gene 19 protein; epididymis secretory sperm binding protein Li 133P; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; EC 1.1.1.27
Gene ID 3939
mRNA Refseq NM_005566
Protein Refseq NP_005557
MIM 150000
UniProt ID P00338

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDHA Products

Required fields are marked with *

My Review for All LDHA Products

Required fields are marked with *

0
cart-icon
0
compare icon