Active Recombinant Human LDHA Protein, His-tagged
Cat.No. : | LDHA-29849TH |
Product Overview : | Recombinant human LDHA (1-332aa) protein with His tag was expressed in E.coli (Bioactivity Validated). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-332 a.a. |
Description : | LDHA, also known as L-lactate dehydrogenase A chain, is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. This protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in LDHA have been linked to exertional myoglobinuria. |
Form : | Liquid |
Bio-activity : | Specific activity is > 300 units/mg, in which one unit will convert 1.0 umole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37C. |
Molecular Mass : | 38.8 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
Purity : | > 95% by SDS - PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL(determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl |
Gene Name | LDHA |
Official Symbol | LDHA lactate dehydrogenase A [ Homo sapiens (human) ] |
Synonyms | LDHA; lactate dehydrogenase A; LDHM; GSD11; PIG19; HEL-S-133P; L-lactate dehydrogenase A chain; LDH muscle subunit; LDH-A; LDH-M; cell proliferation-inducing gene 19 protein; epididymis secretory sperm binding protein Li 133P; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; EC 1.1.1.27 |
Gene ID | 3939 |
mRNA Refseq | NM_005566 |
Protein Refseq | NP_005557 |
MIM | 150000 |
UniProt ID | P00338 |
◆ Recombinant Proteins | ||
LDHA-8843Z | Recombinant Zebrafish LDHA | +Inquiry |
Ldha-1131R | Active Recombinant Rat LDHA protein(Met1-Phe332), His-tagged | +Inquiry |
LDHA-6967HF | Recombinant Full Length Human LDHA Protein, GST-tagged | +Inquiry |
LDHA-4429H | Recombinant Human LDHA Protein (Met1-Phe332), N-His tagged | +Inquiry |
LDHA-30120H | Recombinant Human LDHA protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDHA-8315C | Native Chicken LDHA | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHA-4790HCL | Recombinant Human LDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHA Products
Required fields are marked with *
My Review for All LDHA Products
Required fields are marked with *
0
Inquiry Basket