Active Recombinant Human MMP1 Protein, Tag Free, No Activation Required
| Cat.No. : | MMP1-29H |
| Product Overview : | Recombinant matrix metalloproteinase-1 (MMP-1, fibroblast collagenase, collagenase-1, interstitial collagenase) cloned from human cDNA, expressed in E. coli. The enzyme consists of the catalytic domain of human MMP-1 (residues 106-261, UniProtKB accession P03956). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 106-261 aa |
| Description : | This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. |
| Bio-activity : | > 100 U/μg. Activity described as U = 100 pmol/min at 25 centigrade using a colorimetric assay with thiopeptide Ac-Pro-Leu-Gly-[2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OC2H5 (Biomol) as substrate. |
| Molecular Mass : | 17.6 kDa |
| AASequence : | M-NPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFT160170180190200KVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDED210220230240250ERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQ260DDIDGIQAIYG |
| Purity : | > 95% by SDS-PAGE. The protein is observed, in denaturing conditions, as a single band migrating at a molecular weight between 14.4 and 18.4 kDa. |
| Applications : | Enzyme kinetic studies, cleavage of target substrates and screening of inhibitors. |
| Storage : | At -80 centigrade. After initial defrost, aliquot the product into individual tubes and refreeze at -80 centigrade. Avoid repeated freeze/thaw cycles. |
| Concentration : | 0.2 mg/mL. The concentration is calculated by the analysis of the absorbance at 280 nm (ε280= 28420 M-1cm-1 calculated). |
| Storage Buffer : | Tris 20 mM, pH 7.2, CaCl2 10 mM, ZnCl2 0.1 mM, NaCl 0.3 M, acetohydroxamic acid (AHA) 0.2 M. |
| Gene Name | MMP1 matrix metallopeptidase 1 (interstitial collagenase) [ Homo sapiens (human) ] |
| Official Symbol | MMP1 |
| Synonyms | MMP1; matrix metallopeptidase 1 (interstitial collagenase); CLG, matrix metalloproteinase 1 (interstitial collagenase); interstitial collagenase; fibroblast collagenase; matrix metalloprotease 1; matrix metalloproteinase 1; CLG; CLGN; |
| Gene ID | 4312 |
| mRNA Refseq | NM_001145938 |
| Protein Refseq | NP_001139410 |
| MIM | 120353 |
| UniProt ID | P03956 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP1 Products
Required fields are marked with *
My Review for All MMP1 Products
Required fields are marked with *


