Species : |
Human |
Source : |
Nicotiana Benthamiana |
Tag : |
His |
Protein Length : |
267-375 a.a. |
Description : |
Myostatin (GDF8, MSTN) belongs to the transforming growth factor β (TGFBs) superfamily, which includes : TGF βs, the bone morphogenetic protein (BMPs), growth differentiation factors (GDFs), activins and inhibins. As other members of this superfamily , is synthesized and secreted as a homodimeric prepropeptide that is cleaved by proprotein convertases such as furin to generate the dimeric N- terminal propeptide and the dimeric C-terminal mature active protein.Myostatin is one of the most important protein that controls myoblast proliferation and it is a potent negative regulator of skeletal muscle mass in a number of animal species. Several studies have shown that Myostatin could play an important role in cardiac development and physiology.Genetic deletion of Myostatin or in vivo administration of the Myostatin propeptide induces muscle hypertrophy as well as enhanced glucose utilization and insulin sensitivity and a reduction in overall fat mass. |
Form : |
Lyophilized from a Tris HCl 50mM, Urea 1.5 M, PMSF 0.04mM and Glycine 50mM Buffer pH 8. |
Bio-activity : |
The biological activity of Myostatin is measured by its ability to inhibit mouse plasmacytoma cell line (MPC-11) cells. EC50 30-40ng /mL are required to stimulate a half-maximal response at cytokine saturation. Note: Since applications vary, each investigator should titrate the reagent to obtain optimal results. |
Molecular Mass : |
Recombinant human Myostatin is a homodimer polypeptide chain containing 2X 109 amino acids (267 – 375 of O14793 Growth/differentiation factor 8) and 6 aa Histidine-based tag. It as a predicted molecular mass of 24.8 kDa (13.4 kDa under reducing conditi |
AA Sequence : |
HHHHHHDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGS AGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
Endotoxin : |
< 0.04="" eu="" ug="" protein="" (lal=""> |
Purity : |
>97% by SDS-PAGE gel |
Applications : |
Cell culture, Western blot |
Storage : |
This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : |
Lyophilized protein should be reconstituted in water to a concentration of 5 ng/ul. Due to the protein nature, dimmers and multimers may be observed. Optimal concentration should be determined for specific application and cell lines. Upon reconstitution, It can be stored in working aliquots at –20°C for future use. Optimal reconstitution please follow batch Quality Control sheet instructions. |