Active Recombinant Human NMNAT1, His-tagged
Cat.No. : | NMNAT1-26H |
Product Overview : | Recombinant Human NMNAT1 fused with N-terminal His-tag, was expressed in an E.coli cell expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes an enzyme which catalyzes a key step in the biosynthesis of the coenzyme NAD. The encoded protein is one of several nicotinamide nucleotide adenylyltransferases. Studies in Drosophila and mammalian neurons have shown the encoded protein can confer protection to damaged neurons. This protection requires enzymatic activity which increases NAD levels and activates a nuclear deacetylase which is the protective molecule. Pseudogenes of this gene are located on chromosomes 1, 3, 4, 14 and 15. |
Form : | 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 256 mM imidazole and 20% glycerol |
Bio-activity : | 4200 pmol/min/μg Assay Conditions: The 50 μL reaction mixture contained 50 mM Tris-HCl, pH 7.4, 5 mM MgCl2, 0.1 mM NMN, 0.1 mM ATP, and various amounts of NMNAT. |
Molecular Mass : | 32.8 kDa |
AA Sequence : | MHHHHHHENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGD AYKKKGLIPAYHRVI MAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDC DHQQNSPTLERPGRKRKWTETQDSSQKKSLE PKTKAVPKVKLLCGADLLESFAVPNL WKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEW IANDISSTKIRRA LRRGQSIRYLVPDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT |
Purity : | ≥95% |
Applications : | Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. |
Stability : | >6 months at –80°C |
Gene Name | NMNAT1 nicotinamide nucleotide adenylyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | NMNAT1 |
Synonyms | NMNAT1; LCA9; NMNAT; PNAT1; nicotinamide nucleotide adenylyltransferase 1; NMN adenylyltransferase 1; NaMN adenylyltransferase 1; pyridine nucleotide adenylyltransferase 1; nicotinate-nucleotide adenylyltransferase 1; EC 2.7.7.1; EC 2.7.7.18 |
Gene ID | 64802 |
mRNA Refseq | NM_022787 |
Protein Refseq | NP_073624 |
MIM | 608700 |
UniProt ID | Q9HAN9 |
Chromosome Location | 1p36.22 |
Pathway | Metabolism; Metabolism of vitamins and cofactors; Metabolism of water-soluble vitamins and cofactors |
Function | ATP binding; nicotinamide-nucleotide adenylyltransferase activity; nicotinamide-nucleotide adenylyltransferase activity |
◆ Recombinant Proteins | ||
NMNAT1-6280H | Recombinant Human NMNAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NMNAT1-2400Z | Recombinant Zebrafish NMNAT1 | +Inquiry |
NMNAT1-544H | Recombinant Human NMNAT1, His tagged | +Inquiry |
Nmnat1-4443M | Recombinant Mouse Nmnat1 Protein, Myc/DDK-tagged | +Inquiry |
NMNAT1-25H | Active Recombinant Human NMNAT1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMNAT1-001HCL | Recombinant Human NMNAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMNAT1 Products
Required fields are marked with *
My Review for All NMNAT1 Products
Required fields are marked with *