Active Recombinant Human PAK6

• Cat.No.: PAK6-19H
• Product Overview: PAK6KD is a recombinant wild type human PAK6 kinase domain (amino acids 385–680 of full-length human PAK6) expressed in E. coli and purified to homogeneity with full activity.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Human PAK6 kinase (UniProt: Q9NQU5; NCBI: NM_020168) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK6 was found to interact with androgen receptor.
• Form: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
• Bio-activity: 2,086 pmoles/min/μg
• Molecular Mass: The calculated mass is 34,161. PAK6KD is fully phosphorylated at S560 with a measured mass of 34,242 (1P).
• AA Sequence: GPHPVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVI MRDYQHFNVVEMYKSYLVGEELWVLMEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKS DSILLTLDGRVKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFS DSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLYRKQ TST
• Applications: Enzymatic studies, inhibitor screen, and selectivity profiling
• Storage: Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC.

Gene Information

• Gene Name: PAK6 p21 protein (Cdc42/Rac)-activated kinase 6 [ Homo sapiens ]
• Official Symbol: PAK6
• Synonyms: PAK6; p21 protein (Cdc42/Rac)-activated kinase 6; p21(CDKN1A) activated kinase 6; serine/threonine-protein kinase PAK 6; PAK5; PAK-5; PAK-6; p21-activated kinase 6; p21(CDKN1A)-activated kinase 6; p21-activated protein kinase 6
• Gene ID: 56924
• mRNA Refseq: NM_001128628
• Protein Refseq: NP_001122100
• MIM: 608110
• UniProt ID: Q9NQU5
• Chromosome Location: 15q14
• Pathway: Activation of Rac, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem
• Function: ATP binding; nucleotide binding; protein serine/threonine kinase activity