Active Recombinant Human PAK6
Cat.No. : | PAK6-19H |
Product Overview : | PAK6KD is a recombinant wild type human PAK6 kinase domain (amino acids 385–680 of full-length human PAK6) expressed in E. coli and purified to homogeneity with full activity. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Human PAK6 kinase (UniProt: Q9NQU5; NCBI: NM_020168) belongs to a family of p21-activated kinases. These serine/threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK6 was found to interact with androgen receptor. |
Form : | 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT. |
Bio-activity : | 2,086 pmoles/min/μg |
Molecular Mass : | The calculated mass is 34,161. PAK6KD is fully phosphorylated at S560 with a measured mass of 34,242 (1P). |
AA Sequence : | GPHPVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVI MRDYQHFNVVEMYKSYLVGEELWVLMEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKS DSILLTLDGRVKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFS DSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLYRKQ TST |
Applications : | Enzymatic studies, inhibitor screen, and selectivity profiling |
Storage : | Stable at -70oC for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70oC. |
Gene Name | PAK6 p21 protein (Cdc42/Rac)-activated kinase 6 [ Homo sapiens ] |
Official Symbol | PAK6 |
Synonyms | PAK6; p21 protein (Cdc42/Rac)-activated kinase 6; p21(CDKN1A) activated kinase 6; serine/threonine-protein kinase PAK 6; PAK5; PAK-5; PAK-6; p21-activated kinase 6; p21(CDKN1A)-activated kinase 6; p21-activated protein kinase 6; |
Gene ID | 56924 |
mRNA Refseq | NM_001128628 |
Protein Refseq | NP_001122100 |
MIM | 608110 |
UniProt ID | Q9NQU5 |
Chromosome Location | 15q14 |
Pathway | Activation of Rac, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem; |
Function | ATP binding; nucleotide binding; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
PAK6-381H | Recombinant Human PAK6, GST-tagged, Active | +Inquiry |
PAK6-704HF | Recombinant Full Length Human PAK6 Protein, GST-tagged | +Inquiry |
PAK6-32H | Recombinant Human PAK6 protein, GST-tagged | +Inquiry |
PAK6-1109H | Recombinant Human PAK6 Protein (G383-Y674), His tagged | +Inquiry |
PAK6-9312HF | Active Recombinant Full Length Human PAK6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAK6-3454HCL | Recombinant Human PAK6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAK6 Products
Required fields are marked with *
My Review for All PAK6 Products
Required fields are marked with *
0
Inquiry Basket