Active Recombinant Human PDCD1LG2, Fc-tagged, Biotinylated
| Cat.No. : | PDCD1LG2-661H |
| Product Overview : | The recombinant human PD-L2-Fc fusion is expressed as a 429 amino acid protein consisting of Leu20 - Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 20-220 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds to its receptor PD-1 in a functional ELISA. Blocks its ligand PD-L1"s and PD-L2"s binding to its receptor and mediated signaling activity. |
| Molecular Mass : | Calculated molecular mass 48.2 kDa; estimated by SDS-PAGE under reducing condition ~60 kDa (probably due to glycosylation) |
| AA Sequence : | LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQ VRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHS RTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTSTGTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens ] |
| Official Symbol | PDCD1LG2 |
| Synonyms | PDCD1LG2; programmed cell death 1 ligand 2; B7 dendritic cell molecule; B7 DC; bA574F11.2; Btdc; CD273; PD L2; PDL2; B7-DC; PD-1 ligand 2; PD-1-ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; programmed death ligand 2; B7DC; PD-L2; PDCD1L2; MGC142238; MGC142240; |
| Gene ID | 80380 |
| mRNA Refseq | NM_025239 |
| Protein Refseq | NP_079515 |
| MIM | 605723 |
| UniProt ID | Q9BQ51 |
| Chromosome Location | 9p24.2 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem; |
| Function | molecular_function; protein tyrosine phosphatase activity; receptor activity; |
| ◆ Recombinant Proteins | ||
| PDCD1LG2-052H | Active Recombinant Human PDCD1LG2 protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
| PDCD1LG2-168H | Active Recombinant Human PDCD1LG2, His-tagged | +Inquiry |
| PDCD1LG2-128C | Active Recombinant Cynomolgus PDCD1LG2, Fc tagged | +Inquiry |
| PDCD1LG2-5190H | Recombinant Human PDCD1LG2 Protein (Leu20-Pro219), C-Fc tagged | +Inquiry |
| PDCD1LG2-827HAF488 | Recombinant Human PDCD1LG2 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDCD1LG2-951CCL | Recombinant Cynomolgus PDCD1LG2 cell lysate | +Inquiry |
| PDCD1LG2-2721HCL | Recombinant Human PDCD1LG2 cell lysate | +Inquiry |
| PDCD1LG2-1738MCL | Recombinant Mouse PDCD1LG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDCD1LG2 Products
Required fields are marked with *
My Review for All PDCD1LG2 Products
Required fields are marked with *
