Active Recombinant Human PGLYRP1 Protein, His-tagged

Cat.No. : PGLYRP1-06H
Product Overview : Recombinant human PGLYRP1, fused to His tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-196
Description : Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Peptidoglycan. The ED50 range ≤ 30 ng/mL.
Molecular Mass : 20.5kDa (184aa)
AA Sequence : QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95 % by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL
Storage Buffer : PBS (pH 7.4) containing 10% glycerol
Gene Name PGLYRP1 peptidoglycan recognition protein 1 [ Homo sapiens (human) ]
Official Symbol PGLYRP1
Synonyms PGLYRP1; peptidoglycan recognition protein 1; PGRP; TAG7; PGRPS; PGLYRP; PGRP-S; TNFSF3L; peptidoglycan recognition protein 1; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein)
Gene ID 8993
mRNA Refseq NM_005091
Protein Refseq NP_005082
MIM 604963
UniProt ID O75594

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGLYRP1 Products

Required fields are marked with *

My Review for All PGLYRP1 Products

Required fields are marked with *

0
cart-icon