Active Recombinant Human SERPINI1 protein, Tag Free

Cat.No. : SERPINI1-1670H
Product Overview : Recombinant Human SERPINI1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 17-410 a.a.
Description : Neuroserpin encoded by the SERPINI1 gene in humans is a member of the serine proteinase inhibitor (serpin) family. It reacts preferentially with tissue-type plasminogen activator (tPA). Neuroserpin is expressed mainly in the central nervous system (CNS) in response to neuronal depolarization and plays an important role in the development of synaptic plasticity. Mutations in human neuroserpin result in a form of autosomal dominant inherited dementia which is characterized by the presence of intraneuronal inclusion bodies and is known as Familial Encephalopathy with Neuroserpin Inclusion Bodies.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2000 IU/mg.
Molecular Mass : Approximately 44.7 kDa, a single non-glycosylated polypeptide chain containing 394 amino acid residues.
AA Sequence : TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
Endotoxin : Less than 1 EU/μg of rHuNeuroserpin as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name SERPINI1
Official Symbol SERPINI1
Synonyms SERPINI1; serpin peptidase inhibitor, clade I (neuroserpin), member 1; PI12, serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1; neuroserpin; PI-12; serpin I1; peptidase inhibitor 12; serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1; PI12; DKFZp781N13156;
Gene ID 5274
mRNA Refseq NM_001122752
Protein Refseq NP_001116224
MIM 602445
UniProt ID Q99574

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINI1 Products

Required fields are marked with *

My Review for All SERPINI1 Products

Required fields are marked with *

0
cart-icon
0
compare icon