Active Recombinant Human SHH Protein
Cat.No. : | SHH-240H |
Product Overview : | Recombinant Human SHH Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Sonic hedgehog (SHH) is a member of a small group of hedgehog secreted proteins that are essential for development in both vertebrates and invertebrates. There are three mammalian hedgehog homologues, sonic, desert, and indian, that signal via the Patched-1 and Patched-2 receptors. SHH is a morphogen that is essential during vertebrate organogenesis and adult stem cell division. |
Bio-activity : | CCL-226 cell proliferation, ≤5 μg/mL; ≥200 units/mg |
Molecular Mass : | Monomer, 20.2 kDa (179 aa) |
AA Sequence : | MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRALDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | SHH sonic hedgehog [ Homo sapiens (human) ] |
Official Symbol | SHH |
Synonyms | SHH; sonic hedgehog; HLP3, HPE3, sonic hedgehog (Drosophila) homolog , sonic hedgehog homolog (Drosophila); sonic hedgehog protein; HHG1; MCOPCB5; SMMCI; TPT; TPTPS; sonic hedgehog homolog; HLP3; HPE3; |
Gene ID | 6469 |
mRNA Refseq | NM_000193 |
Protein Refseq | NP_000184 |
MIM | 600725 |
UniProt ID | Q15465 |
◆ Recombinant Proteins | ||
Shh-1316M | Recombinant Mouse Shh protein | +Inquiry |
Shh-5863M | Recombinant Mouse Shh Protein, Myc/DDK-tagged | +Inquiry |
SHH-486H | Recombinant Human SHH | +Inquiry |
SHH-7284H | Recombinant Human SHH protein, His-tagged | +Inquiry |
Shh-8701M | Recombinant Mouse Shh protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHH-1494HCL | Recombinant Human SHH cell lysate | +Inquiry |
SHH-1176MCL | Recombinant Mouse SHH cell lysate | +Inquiry |
SHH-1533HCL | Recombinant Human SHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHH Products
Required fields are marked with *
My Review for All SHH Products
Required fields are marked with *