Active Recombinant Human SHH Protein

Cat.No. : SHH-240H
Product Overview : Recombinant Human SHH Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Sonic hedgehog (SHH) is a member of a small group of hedgehog secreted proteins that are essential for development in both vertebrates and invertebrates. There are three mammalian hedgehog homologues, sonic, desert, and indian, that signal via the Patched-1 and Patched-2 receptors. SHH is a morphogen that is essential during vertebrate organogenesis and adult stem cell division.
Bio-activity : CCL-226 cell proliferation, ≤5 μg/mL; ≥200 units/mg
Molecular Mass : Monomer, 20.2 kDa (179 aa)
AA Sequence : MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRALDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFP
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name SHH sonic hedgehog [ Homo sapiens (human) ]
Official Symbol SHH
Synonyms SHH; sonic hedgehog; HLP3, HPE3, sonic hedgehog (Drosophila) homolog , sonic hedgehog homolog (Drosophila); sonic hedgehog protein; HHG1; MCOPCB5; SMMCI; TPT; TPTPS; sonic hedgehog homolog; HLP3; HPE3;
Gene ID 6469
mRNA Refseq NM_000193
Protein Refseq NP_000184
MIM 600725
UniProt ID Q15465

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SHH Products

Required fields are marked with *

My Review for All SHH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon