Active Recombinant Human SLAMF6, Fc-tagged, Biotinylated

Cat.No. : SLAMF6-687H
Product Overview : The recombinant human SLAMF6-Fc fusion protein is expressed as a 432-amino acid protein consisting of Gln22 - Lys225 region of SLAMF6 (UniProt accession #Q96DU3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 22-225 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized SLAMF6 interacts homophilically with SLAMF6 in a functional ELISA
Molecular Mass : Calculated molecular mass (kDa): 48.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
AA Sequence : QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQ LSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEAL GNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKSTGTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name SLAMF6 SLAM family member 6 [ Homo sapiens ]
Official Symbol SLAMF6
Synonyms SLAMF6; SLAM family member 6; CD352; KALI; KALIb; Ly108; NTB A; NTBA; SF2000; NTBA receptor; NK-T-B-antigen; activating NK receptor; natural killer-, T- and B-cell antigen; NTB-A; FLJ50657; MGC104953;
Gene ID 114836
mRNA Refseq NM_001184714
Protein Refseq NP_001171643
MIM 606446
UniProt ID Q96DU3
Chromosome Location 1q23.1
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLAMF6 Products

Required fields are marked with *

My Review for All SLAMF6 Products

Required fields are marked with *

0
cart-icon