Active Recombinant Human SLAMF6, Fc-tagged, Biotinylated
| Cat.No. : | SLAMF6-687H |
| Product Overview : | The recombinant human SLAMF6-Fc fusion protein is expressed as a 432-amino acid protein consisting of Gln22 - Lys225 region of SLAMF6 (UniProt accession #Q96DU3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 22-225 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Immobilized SLAMF6 interacts homophilically with SLAMF6 in a functional ELISA |
| Molecular Mass : | Calculated molecular mass (kDa): 48.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 |
| AA Sequence : | QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQ LSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEAL GNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKSTGTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | SLAMF6 SLAM family member 6 [ Homo sapiens ] |
| Official Symbol | SLAMF6 |
| Synonyms | SLAMF6; SLAM family member 6; CD352; KALI; KALIb; Ly108; NTB A; NTBA; SF2000; NTBA receptor; NK-T-B-antigen; activating NK receptor; natural killer-, T- and B-cell antigen; NTB-A; FLJ50657; MGC104953; |
| Gene ID | 114836 |
| mRNA Refseq | NM_001184714 |
| Protein Refseq | NP_001171643 |
| MIM | 606446 |
| UniProt ID | Q96DU3 |
| Chromosome Location | 1q23.1 |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| SLAMF6-5600H | Recombinant Human SLAMF6 Protein (Leu28-Lys225), C-His tagged | +Inquiry |
| SLAMF6-1775R | Recombinant Rhesus Monkey SLAMF6 Protein, hIgG4-tagged | +Inquiry |
| Slamf6-4020M | Active Recombinant Mouse SLAMF6 protein, His-tagged | +Inquiry |
| SLAMF6-374H | Recombinant Human SLAM family member 6, His-tagged | +Inquiry |
| SLAMF6-3945H | Recombinant Human SLAMF6, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLAMF6-2108MCL | Recombinant Mouse SLAMF6 cell lysate | +Inquiry |
| SLAMF6-913HCL | Recombinant Human SLAMF6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF6 Products
Required fields are marked with *
My Review for All SLAMF6 Products
Required fields are marked with *
