Active Recombinant Human SLC3A2, Fc-tagged
Cat.No. : | SLC3A2-588H |
Product Overview : | The recombinant human CD98-Fc is expressed as a 648 amino acid protein consisting of Arg110 - Ala529 region of CD98 (UniProt Accession # P08195 - isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 110-529 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Immobilized CD98 protein binds anti-CD98 monoclonal antibody human IgG1 with high affinity (KD< 10="" nm)="" in="" a="" functional="" elisa.="" blocks="" cd98/lat-mediated="" amino="" acid="" transporter="" and="" signaling=""> |
Molecular Mass : | Calculated molecular mass (kDa): 71.8; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 |
AA Sequence : | RELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNF GSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASS FLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCS WSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSAN MTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQA SDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAASTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | SLC3A2 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [ Homo sapiens ] |
Official Symbol | SLC3A2 |
Synonyms | SLC3A2; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; MDU1; 4F2 cell-surface antigen heavy chain; 4F2; 4F2 cell surface antigen heavy chain; 4F2 heavy chain; 4F2HC; 4T2HC; antigen defined by monoclonal 4F2; antigen identified by monoclonal antibodies 4F2; TRA1.10; TROP4; and T43; CD98; CD98 heavy chain; CD98HC; heavy chain; lymphocyte activation antigen 4F2 large subunit; monoclonal 44D7; NACAE; antigen defined by monoclonal 4F2, heavy chain; antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43; |
Gene ID | 6520 |
mRNA Refseq | NM_001012662 |
Protein Refseq | NP_001012680 |
MIM | 158070 |
UniProt ID | P08195 |
Chromosome Location | 11q12-q22 |
Pathway | Amino acid transport across the plasma membrane, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
Function | calcium:sodium antiporter activity; catalytic activity; cation binding; neutral amino acid transmembrane transporter activity; protein binding; |
◆ Recombinant Proteins | ||
Slc3a2-1197R | Recombinant Rat Slc3a2 protein, His & GST-tagged | +Inquiry |
SLC3A2-2592H | Recombinant Human SLC3A2 protein(271-390 aa), C-His-tagged | +Inquiry |
SLC3A2-1425H | Recombinant Human SLC3A2 Protein (Leu213-Asp349), N-His tagged | +Inquiry |
SLC3A2-1057H | Recombinant Human SLC3A2 protein(Arg206-Ala630), His-tagged, Biotinylated | +Inquiry |
Slc3a2-1196M | Recombinant Mouse Slc3a2 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC3A2-2015HCL | Recombinant Human SLC3A2 cell lysate | +Inquiry |
SLC3A2-1772MCL | Recombinant Mouse SLC3A2 cell lysate | +Inquiry |
SLC3A2-1199RCL | Recombinant Rat SLC3A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC3A2 Products
Required fields are marked with *
My Review for All SLC3A2 Products
Required fields are marked with *
0
Inquiry Basket