| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
59 |
| Description : |
The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are secreted in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF-3 is expressed by goblet cells and in the uterus, and has also been shown to express in certain cancers, including colorectal, hepatocellular, and in biliary tumors. TFF3 may be useful as a molecular marker for certain types of cancer, but its role, if any, in tumorigenesis is unknown. TFF3 also promotes airway epithelial cell migration and differentiation. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1.0-10.0 μg/mL. |
| Molecular Mass : |
Approximately 6.5 kDa, a single non-glycosylated polypeptide chain containing 59 amino acids. |
| AA Sequence : |
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
| Endotoxin : |
Less than 1 EU/μg of rHuTFF3 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analyses. |
| Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : |
Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |