Active Recombinant Human TFF3 Protein (59 aa)
Cat.No. : | TFF3-112T |
Product Overview : | Recombinant Human TFF3 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 59 |
Description : | The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are secreted in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF-3 is expressed by goblet cells and in the uterus, and has also been shown to express in certain cancers, including colorectal, hepatocellular, and in biliary tumors. TFF3 may be useful as a molecular marker for certain types of cancer, but its role, if any, in tumorigenesis is unknown. TFF3 also promotes airway epithelial cell migration and differentiation. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1.0-10.0 μg/mL. |
Molecular Mass : | Approximately 6.5 kDa, a single non-glycosylated polypeptide chain containing 59 amino acids. |
AA Sequence : | EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
Endotoxin : | Less than 1 EU/μg of rHuTFF3 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TFF3 trefoil factor 3 (intestinal) [ Homo sapiens ] |
Official Symbol | TFF3 |
Synonyms | TFF3; trefoil factor 3 (intestinal); trefoil factor 3; HITF; ITF; polypeptide P1.B; P1B; TFI; |
Gene ID | 7033 |
mRNA Refseq | NM_003226 |
Protein Refseq | NP_003217 |
MIM | 600633 |
UniProt ID | Q07654 |
◆ Recombinant Proteins | ||
TFF3-6322D | Recombinant Dog TFF3 protein, His-tagged | +Inquiry |
TFF3-6875D | Recombinant Dog TFF3 protein, His&Myc-tagged | +Inquiry |
TFF3-973H | Recombinant Human Trefoil Factor 3 | +Inquiry |
TFF3-1758C | Recombinant Cattle TFF3 protein, His & GST-tagged | +Inquiry |
TFF3-6422H | Recombinant Human TFF3 Protein (Met22-Val80), N-GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFF3 Products
Required fields are marked with *
My Review for All TFF3 Products
Required fields are marked with *
0
Inquiry Basket