Active Recombinant Human TGFB2, His-tagged
Cat.No. : | TGFB2-22H |
Product Overview : | Recombinant Human TGFB2, expressed in Nicotiana benthamiana. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | His |
Description : | TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-β (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological pr centigradeesses as embryogenesis, tissue remodelling and wound healing. |
Form : | Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4. |
Bio-activity : | The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50< 40ng/ml,="" corresponding="" to="" a="" specific="" activity="" of="" 25,000=""> |
Molecular Mass : | TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques. |
Purity : | Greater than 97.0% as determined by SDS-PAGE. |
Unit Definition : | HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS. |
Usage : | FOR RESEARCH USE ONLY |
Quality Control Test : | Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution TGFB2 Human should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Reconstitution : | It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M?-cm H2O not less than 1μg/40μl, which can then be further diluted to other aqueous solutions. |
Warning : | Avoid repeated freeze-thaw cycles. |
Gene Name | TGFB2 transforming growth factor, beta 2 [ Homo sapiens ] |
Official Symbol | TGFB2 |
Synonyms | TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892; |
Gene ID | 7042 |
mRNA Refseq | NM_001135599 |
Protein Refseq | NP_001129071 |
MIM | 190220 |
UniProt ID | P61812 |
Chromosome Location | 1q41 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; |
Function | beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; |
◆ Recombinant Proteins | ||
TGFB2-1566H | Recombinant human TGFB2, Active | +Inquiry |
TGFB2-104H | Active Recombinant Human TGFB2 Protein | +Inquiry |
TGFB2-8954B | Recombinant Bovine TGFB2 protein, His-tagged | +Inquiry |
TGFB2-1253C | Recombinant Chicken TGFB2 Protein, His-tagged | +Inquiry |
TGFB2-127M | Recombinant Mouse TGFB2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB2-1119HCL | Recombinant Human TGFB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFB2 Products
Required fields are marked with *
My Review for All TGFB2 Products
Required fields are marked with *