Active Recombinant Human TGFB2, His-tagged

Cat.No. : TGFB2-22H
Product Overview : Recombinant Human TGFB2, expressed in Nicotiana benthamiana.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : His
Description : TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-β (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological pr centigradeesses as embryogenesis, tissue remodelling and wound healing.
Form : Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.
Bio-activity : The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50< 40ng/ml,="" corresponding="" to="" a="" specific="" activity="" of="" 25,000="">
Molecular Mass : TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
Purity : Greater than 97.0% as determined by SDS-PAGE.
Unit Definition : HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTIN PEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS.
Usage : FOR RESEARCH USE ONLY
Quality Control Test : Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution TGFB2 Human should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M?-cm H2O not less than 1μg/40μl, which can then be further diluted to other aqueous solutions.
Warning : Avoid repeated freeze-thaw cycles.
Gene Name TGFB2 transforming growth factor, beta 2 [ Homo sapiens ]
Official Symbol TGFB2
Synonyms TGFB2; transforming growth factor, beta 2; transforming growth factor beta-2; G-TSF; cetermin; polyergin; BSC-1 cell growth inhibitor; glioblastoma-derived T-cell suppressor factor; TGF-beta2; MGC116892;
Gene ID 7042
mRNA Refseq NM_001135599
Protein Refseq NP_001129071
MIM 190220
UniProt ID P61812
Chromosome Location 1q41
Pathway ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem;
Function beta-amyloid binding; cytokine activity; growth factor activity; protein binding; contributes_to protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFB2 Products

Required fields are marked with *

My Review for All TGFB2 Products

Required fields are marked with *

0
cart-icon