Active Recombinant Human TNFRSF13C Protein (1-78aa), C-hIgG-His tagged
Cat.No. : | TNFRSF13C-05H |
Product Overview : | Recombinant human BAFFR (1-78aa), fused to hIgG-tag at Cterminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 1-78aa |
Description : | B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Human BAFF. The ED50 range ≤ 0.7 μg/mL. |
Molecular Mass : | 34.4 kDa (314aa) |
AA Sequence : | < DGS> MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLL< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK> |
Endotoxin : | < 1.0 EU/μg of the protein by the LAL method. |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens (human) ] |
Official Symbol | TNFRSF13C |
Synonyms | TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor; CVID4; BAFF-R; BROMIX; prolixin; MGC138235; |
Gene ID | 115650 |
mRNA Refseq | NM_052945 |
Protein Refseq | NP_443177 |
MIM | 606269 |
UniProt ID | Q96RJ3 |
◆ Recombinant Proteins | ||
Tnfrsf13c-365R | Recombinant Rat Tnfrsf13c Protein, His-tagged | +Inquiry |
Tnfrsf13c-217M | Recombinant Mouse Tnfrsf13c protein, His/S-tagged | +Inquiry |
Tnfrsf13c-573M | Recombinant Mouse Tnfrsf13c protein, Fc-tagged | +Inquiry |
TNFRSF13C-3992H | Recombinant Human TNFRSF13C Protein (Arg2-Ala71), C-Fc tagged | +Inquiry |
TNFRSF13C-9287H | Active Recombinant Human TNFRSF13C Protein, His-tagged, Site-specific PE-Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13C-831RCL | Recombinant Rat TNFRSF13C cell lysate | +Inquiry |
TNFRSF13C-1861MCL | Recombinant Mouse TNFRSF13C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF13C Products
Required fields are marked with *
My Review for All TNFRSF13C Products
Required fields are marked with *