Active Recombinant Human TNFRSF13C Protein (1-78aa), C-hIgG-His tagged

Cat.No. : TNFRSF13C-05H
Product Overview : Recombinant human BAFFR (1-78aa), fused to hIgG-tag at Cterminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : 1-78aa
Description : B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human BAFF. The ED50 range ≤ 0.7 μg/mL.
Molecular Mass : 34.4 kDa (314aa)
AA Sequence : < DGS> MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLL< LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK>
Endotoxin : < 1.0 EU/μg of the protein by the LAL method.
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens (human) ]
Official Symbol TNFRSF13C
Synonyms TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor; CVID4; BAFF-R; BROMIX; prolixin; MGC138235;
Gene ID 115650
mRNA Refseq NM_052945
Protein Refseq NP_443177
MIM 606269
UniProt ID Q96RJ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF13C Products

Required fields are marked with *

My Review for All TNFRSF13C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon