Active Recombinant Human TNFRSF13C protein, hFc-Flag-tagged
Cat.No. : | TNFRSF13C-4601H |
Product Overview : | Recombinant Human TNFRSF13C protein(Q96RJ3)(7-71aa), fused to C-terminal hFc tag and Flag tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Fc&Flag |
Protein Length : | 7-71aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml.Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.2699-0.5613 ng/ml. |
Molecular Mass : | 36.4 kDa |
AA Sequence : | SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens ] |
Official Symbol | TNFRSF13C |
Synonyms | TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor; CVID4; BAFF-R; BROMIX; prolixin; MGC138235; |
Gene ID | 115650 |
mRNA Refseq | NM_052945 |
Protein Refseq | NP_443177 |
MIM | 606269 |
UniProt ID | Q96RJ3 |
◆ Recombinant Proteins | ||
TNFRSF13C-39H | Recombinant Human TNFRSF13C protein | +Inquiry |
TNFRSF13C-3992H | Recombinant Human TNFRSF13C Protein (Arg2-Ala71), C-Fc tagged | +Inquiry |
TNFRSF13C-6744C | Recombinant Cynomolgus TNFRSF13C protein, His-tagged | +Inquiry |
TNFRSF13C-551H | Active Recombinant Human TNFRSF13C, Fc-tagged, Biotinylated | +Inquiry |
TNFRSF13C-319CB | Recombinant Cynomolgus TNFRSF13C protein, His-Avi-Flag-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13C-831RCL | Recombinant Rat TNFRSF13C cell lysate | +Inquiry |
TNFRSF13C-1861MCL | Recombinant Mouse TNFRSF13C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF13C Products
Required fields are marked with *
My Review for All TNFRSF13C Products
Required fields are marked with *
0
Inquiry Basket