Active Recombinant Human TNFRSF13C protein, hFc-Flag-tagged

• Cat.No.: TNFRSF13C-4601H
• Product Overview: Recombinant Human TNFRSF13C protein(Q96RJ3)(7-71aa), fused to C-terminal hFc tag and Flag tag, was expressed in Mammalian cell.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Fc&Flag
• Protein Length: 7-71aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml.Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.2699-0.5613 ng/ml.
• Molecular Mass: 36.4 kDa
• AA Sequence: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens ]
• Official Symbol: TNFRSF13C
• Synonyms: TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor; CVID4; BAFF-R; BROMIX; prolixin; MGC138235
• Gene ID: 115650
• mRNA Refseq: NM_052945
• Protein Refseq: NP_443177
• MIM: 606269
• UniProt ID: Q96RJ3