Active Recombinant Human TNFSF18 protein, hFc-Flag-tagged

Cat.No. : TNFSF18-4604H
Product Overview : Recombinant Human TNFSF18 protein(Q9UNG2)(72-199aa), fused to N-terminal hFc tag and Flag tag, was expressed in Mammalian cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Fc&Flag
Protein Length : 72-199aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml. Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay.
Molecular Mass : 42.8 kDa
AA Sequence : QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Purity : Greater than 94% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name TNFSF18 tumor necrosis factor (ligand) superfamily, member 18 [ Homo sapiens ]
Official Symbol TNFSF18
Synonyms TNFSF18; tumor necrosis factor (ligand) superfamily, member 18; tumor necrosis factor ligand superfamily member 18; AITRL; hGITRL; TL6; AITR ligand; GITR ligand; activation-inducible TNF-related ligand; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced TNFR-related protein ligand; GITRL; MGC138237;
Gene ID 8995
mRNA Refseq NM_005092
Protein Refseq NP_005083
MIM 603898
UniProt ID Q9UNG2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF18 Products

Required fields are marked with *

My Review for All TNFSF18 Products

Required fields are marked with *

0
cart-icon