Active Recombinant Human TNFSF18 protein, hFc-Flag-tagged
Cat.No. : | TNFSF18-4604H |
Product Overview : | Recombinant Human TNFSF18 protein(Q9UNG2)(72-199aa), fused to N-terminal hFc tag and Flag tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Fc&Flag |
Protein Length : | 72-199aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml. Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 94% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | TNFSF18 tumor necrosis factor (ligand) superfamily, member 18 [ Homo sapiens ] |
Official Symbol | TNFSF18 |
Synonyms | TNFSF18; tumor necrosis factor (ligand) superfamily, member 18; tumor necrosis factor ligand superfamily member 18; AITRL; hGITRL; TL6; AITR ligand; GITR ligand; activation-inducible TNF-related ligand; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced TNFR-related protein ligand; GITRL; MGC138237; |
Gene ID | 8995 |
mRNA Refseq | NM_005092 |
Protein Refseq | NP_005083 |
MIM | 603898 |
UniProt ID | Q9UNG2 |
◆ Recombinant Proteins | ||
TNFSF18-3780H | Recombinant Human TNFSF18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF18-640H | Recombinant Human TNFSF18 Protein (Glu52-Ser177), His-tagged | +Inquiry |
TNFSF18-641H | Recombinant Human TNFSF18 Protein (Gln72-Ser199), HIgG1 Fc-tagged | +Inquiry |
TNFSF18-168H | Recombinant Human TNFSF18 protein, His/S-tagged | +Inquiry |
TNFSF18-668M | Recombinant Mouse TNFSF18 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF18-890HCL | Recombinant Human TNFSF18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF18 Products
Required fields are marked with *
My Review for All TNFSF18 Products
Required fields are marked with *