Active Recombinant Human TNFSF8, His-tagged, Biotinylated
| Cat.No. : | TNFSF8-569H |
| Product Overview : | The recombinant human CD30 ECD is expressed as a 368 amino acid protein consisting of Phe19 - Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal His-tag. It contains 2 potential sites for N-linked glycosylation. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | His |
| Protein Length : | 19-378 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds to its ligand CD30L in a functional ELISA and anti-CD30 monoclonal antibodies with high affinity. Blocks CD30 Ligand-induced IL-6 secretion by human Hodgkin"s lymphoma cells |
| Molecular Mass : | Calculated molecular mass (kDa): 39.4; Estimated by SDS-PAGE under reducing condition (kDa): 70-80 |
| AA Sequence : | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDL VEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENC KEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKP QDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGHHHHHHHH |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >90% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ] |
| Official Symbol | TNFSF8 |
| Synonyms | TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144; |
| Gene ID | 944 |
| mRNA Refseq | NM_001244 |
| Protein Refseq | NP_001235 |
| MIM | 603875 |
| UniProt ID | P32971 |
| Chromosome Location | 9q33 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
| Function | cytokine activity; receptor binding; tumor necrosis factor receptor binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF8 Products
Required fields are marked with *
My Review for All TNFSF8 Products
Required fields are marked with *
