Active Recombinant M. tuberculosis pepA Protein, His tagged
| Cat.No. : | pepA-023M |
| Product Overview : | Recombinant MTB pepA protein with C-terminus 6 His tag was produced from E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | M.tuberculosis |
| Source : | E.coli |
| Tag : | His |
| Description : | MTB pepA, also known as Mtb32a belongs to the serine protease family of proteins. It is conserved across M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis. It was identified in culture supernatant of MTB H37Rv strain and is predicted to be essential for in vivo survival and pathogenicity in Mycobacterium. This can serve as a candidate target for TB therapies. |
| Form : | Lyophilized powder. Dilute to 1 mg/mL in PBS |
| AASequence : | MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPLDPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGGPVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNGARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLAEGPPA |
| Purity : | > 95 %, purified by Ni NTA and determined by SDS-PAGE. |
| Applications : | Tuberculosis research |
| Storage : | Store at -20 centigrade, for extended storage |
| Shipping : | Cold packs |
| Gene Name | pepA serine protease PepA [ Mycobacterium tuberculosis H37Rv ] |
| Official Symbol | pepA |
| Synonyms | pepA; serine protease PepA; mtb32a; serine protease PepA; Belongs to the serine protease family |
| Gene ID | 886924 |
| Protein Refseq | NP_214639 |
| UniProt ID | A0A2I7W2M2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All pepA Products
Required fields are marked with *
My Review for All pepA Products
Required fields are marked with *
