Active Recombinant M. tuberculosis pepA Protein, His tagged

Cat.No. : pepA-023M
Product Overview : Recombinant MTB pepA protein with C-terminus 6 His tag was produced from E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : M.tuberculosis
Source : E.coli
Tag : His
Description : MTB pepA, also known as Mtb32a belongs to the serine protease family of proteins. It is conserved across M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis. It was identified in culture supernatant of MTB H37Rv strain and is predicted to be essential for in vivo survival and pathogenicity in Mycobacterium. This can serve as a candidate target for TB therapies.
Form : Lyophilized powder. Dilute to 1 mg/mL in PBS
AASequence : MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPLDPSAMVAQVGPQVVNINTKLGYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPSAAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGGPVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGNGARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLAEGPPA
Purity : > 95 %, purified by Ni NTA and determined by SDS-PAGE.
Applications : Tuberculosis research
Storage : Store at -20 centigrade, for extended storage
Shipping : Cold packs
Gene Name pepA serine protease PepA [ Mycobacterium tuberculosis H37Rv ]
Official Symbol pepA
Synonyms pepA; serine protease PepA; mtb32a; serine protease PepA; Belongs to the serine protease family
Gene ID 886924
Protein Refseq NP_214639
UniProt ID A0A2I7W2M2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All pepA Products

Required fields are marked with *

My Review for All pepA Products

Required fields are marked with *

0
cart-icon
0
compare icon