Active Recombinant MERS-CoV Spike RBD Protein (358-606aa), C-His-tagged

Cat.No. : S-12M
Product Overview : Recombinant MERS-CoV Spike RBD (358-606aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability October 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : MERS-CoV
Source : Insect Cells
Tag : His
Protein Length : 358-606 aa
Description : MERS-CoV, which causes the Middles East Respiratory Syndrome (MERS), belongs to a family of viruses known as coronaviruses. MERS-CoV was first identified in the Kingdom of Saudi Arabia in 2012, which is a single and positive stranded RNA virus. Dromedary camels are widely considered as the source of the transmission of MERSCoV. The rate of human transmission among household contacts of MERS patients has been approximately 5 % based on serological analysis. MERS-CoV has four structural proteins, known as the S (spike), E (envelope), M (membrane), and N (nucleocapsid) proteins. The spike protein, responsible for allowing the virus to attach to and fuse with the membrane of a host cell and is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion. MERS-CoV S mediates viral attachment and fusion to human cells via human cellular receptor DPP4, also known as CD26. The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human DPPIV/CD26.
Molecular Mass : 28.2 kDa(258 aa)
AA Sequence : SGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280 nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name S spike protein [ Middle East respiratory syndrome-related coronavirus ]
Official Symbol S
Synonyms S; spike protein; surface glycoprotein
Gene ID 14254594
Protein Refseq YP_009047204
UniProt ID K0BRG7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S Products

Required fields are marked with *

My Review for All S Products

Required fields are marked with *

0
cart-icon
0
compare icon