Active Recombinant Mouse 4632428N05Rik, Fc-tagged
Cat.No. : | C10orf54-26M |
Product Overview : | Recombinant Mouse 4632428N05Rik(Phe33 - Ala191), exists as a dimer under non-reducing condition, fused to Fc fusion from human IgG1 at C-terminus, was expressed in Human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 33-191 a.a. |
Description : | B7-H5 (B7 homolog 5), also known as platelet receptor Gi24, C10orf54, Dies1, VISTA, PD-1H and SISP1, is a single-pass type I transmembrane glycoprotein that belongs to the B7 family of the Ig superfamily. Unlike other B7 family members that usually contain one Ig V-like and one Ig C-like domain in the extracellular region, mature B7-H5 has only one Ig V- like domain. B7-H5 is expressed in bone, on embryonic stem cells (ESCs), and on tumor cell surfaces. On ESCs, it interacts with BMP-4 and potentiates BMP signaling and the transition from an undifferentiated to a differentiated state. On tumor cells, B7-H5 both promotes MT1-MMP expression and activity and serves as a substrate for MT1-MMP. This increases the potential for cell motility. B7-H5 can be shed by MT1MMP, generating a soluble 30 kDa extracellular fragment and a 25-30 kDa membrane-bound fragment. B7-H5 is expressed on the surface of naïve CD4+ T cells and regulatory T cells. Its expression is upregulated in vivo on activated monocytes and dendritic cells. It is reported that B7-H5 inhibits CD4+ and CD8+ T cell proliferation, and their production of IL2 and IFNγ. Its expression on tumor cells attenuates the antitumor immune response and enables more rapid tumor progression. In contrast, it has also been reported that B7-H5 limits disease progression in the autoimmune disease model EAE. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). |
Bio-activity : | Inhibits antiCD3e antibody induced IL2 secretion and T cell proliferation. |
Molecular Mass : | Calculated molecular mass 43.3 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation |
AA Sequence : | FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAA NTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVY PSSSQDSENITAASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Stability : | It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
Warning : | FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN. |
Gene Name | 4632428N05Rik RIKEN cDNA 4632428N05 gene [ Mus musculus ] |
Official Symbol | 4632428N05Rik |
Synonyms | Dies1; PD-1H; VISTA; platelet receptor Gi24; differentiation of ESCs 1 |
Gene ID | 74048 |
mRNA Refseq | NM_001159572 |
Protein Refseq | NP_001153044 |
UniProt ID | Q9D659 |
Chromosome Location | 10; 10 B4 |
Function | protein binding |
◆ Recombinant Proteins | ||
C10orf54-171H | Recombinant Human C10orf54 Protein, His (Fc)-Avi-tagged | +Inquiry |
C10orf54-1024H | Recombinant Human C10orf54 protein, His-tagged | +Inquiry |
C10orf54-313H | Recombinant Human C10orf54 protein, His-tagged | +Inquiry |
C10orf54-26M | Active Recombinant Mouse 4632428N05Rik, Fc-tagged | +Inquiry |
C10orf54-539HAF555 | Recombinant Human C10orf54 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
C10ORF54-1249HCL | Recombinant Human C10ORF54 cell lysate | +Inquiry |
C10orf54-8365HCL | Recombinant Human C10orf54 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C10orf54 Products
Required fields are marked with *
My Review for All C10orf54 Products
Required fields are marked with *
0
Inquiry Basket