Active Recombinant Mouse Ccl19 Protein (83 aa)

Name: Active Recombinant Mouse Ccl19 Protein (83 aa)
SKU: Ccl19-022C

Species :	Mouse
Source :	E.coli
Protein Length :	83
Description :	Macrophage Inflammatory Protein-3 beta also called CCL19, ELC (EBI1 Ligand Chemokine), Exodus-3 is a reported β chemokine that binds specifically to the chemokine receptor CCR7/EBI1/BLR2. It is expressed in the thymus, lymph nodes and in activated bone marrow stromal cells. MIP-3 beta is a chemoattractant for T and B lymphocytes and myeloid progenitor cells.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	Measured by its ability to chemoattract human CCR7 transfected BaF3 mouse proB cells. The ED50 for this effect is typically 3-15 ng/mL.
Molecular Mass :	Approximately 9.2 kDa, a single non-glycosylated polypeptide chain containing 83 amino acids.
AA Sequence :	GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
Endotoxin :	Less than 1 EU/μg of rMuMIP-3b/CCL19 as determined by LAL method.
Purity :	>95% by SDS-PAGE and HPLC analyses.
Storage :	This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer :	Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.

Gene Name	Ccl19 chemokine (C-C motif) ligand 19 [ Mus musculus ]
Official Symbol	Ccl19
Synonyms	CCL19; chemokine (C-C motif) ligand 19; C-C motif chemokine 19; chemokine CCL19; EBI1 ligand chemokine; EBI1-ligand chemokine; EBI-1 ligand chemokine; small inducible cytokine A19; small-inducible cytokine A19; EBV-induced molecule 1 ligand chemokine; epstein-Barr virus-induced molecule 1 ligand chemokine; ELC; CKb11; MIP3B; Scya19; exodus-3;
Gene ID	24047
mRNA Refseq	NM_011888
Protein Refseq	NP_036018
UniProt ID	O70460