Active Recombinant Mouse Cxcl15 Protein
| Cat.No. : | Cxcl15-136M |
| Product Overview : | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 15 (Cxcl15) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions. |
| Bio-activity : | Determined by its ability to chemoattract human neutrophils using a concentration range of 20.0-100.0 ng/ml. |
| Molecular Mass : | 16.3 kDa |
| AA Sequence : | QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA |
| Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
| Gene Name | Cxcl15 chemokine (C-X-C motif) ligand 15 [ Mus musculus (house mouse) ] |
| Official Symbol | Cxcl15 |
| Synonyms | Cxcl15; chemokine (C-X-C motif) ligand 15; Il8; weche; Scyb15; lungkine; C-X-C motif chemokine 15; interleukin 8; small inducible cytokine subfamily B, member 15; small-inducible cytokine B15 |
| Gene ID | 20309 |
| mRNA Refseq | NM_011339 |
| Protein Refseq | NP_035469 |
| UniProt ID | Q9WVL7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl15 Products
Required fields are marked with *
My Review for All Cxcl15 Products
Required fields are marked with *
