Active Recombinant Mouse Defb2 Protein (51 aa)

Cat.No. : Defb2-036D
Product Overview : Recombinant Mouse Defb2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 51
Description : Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins are distinguished from the β-defensins by the pairing of their three disulfide bonds. To date, four β-defensins have been identified; BD-1, BD-2, BD-3 and BD-4. β-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they are chemoattractant towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal sequence and, in the case of BD-1 (36 a.a.), a propeptide region. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Determined Sterile Filtered White lyophilized (freeze-dried) powder.by its ability to chemoattract immature human dendritic cells using a concentration of 10.0-100.0 ng/mL.
Molecular Mass : Approximately 5.54 kDa, a single non-glycosylated polypeptide chain containing 51 amino acids.
AA Sequence : AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK
Endotoxin : Less than 1 EU/mg of rMuBD-2 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Defb2 defensin beta 2 [ Mus musculus (house mouse) ]
Official Symbol Defb2
Synonyms Defb2; defensin beta 2; BD-2; beta-defensin 2
Gene ID 13215
mRNA Refseq NM_010030
Protein Refseq NP_034160
UniProt ID P82020

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Defb2 Products

Required fields are marked with *

My Review for All Defb2 Products

Required fields are marked with *

0
cart-icon