| Species : |
Mouse |
| Source : |
HEK293 |
| Tag : |
His |
| Description : |
Ubiquitous expression in testis adult (RPKM 27.5), genital fat pad adult (RPKM 15.1) and 28 other tissues. |
| Form : |
Liquid |
| Bio-activity : |
Specific activity is > 80,000 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze GDP per minute at pH 7.5 at 25 centigrade. |
| Molecular Mass : |
47.3 kDa |
| AA Sequence : |
KWHRASAAQAFFTIAGAASGARWTQQAFSSPGSAARGHEVFYGIMFDAGSTGTRIHVFQFARPPGETPTLTHETFKALKPGLSAYADDVEKSAQGIQELLNVAKQHIPYDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITVNFLTGSLKTPGSSSVGMLDLGGGSTQITFLPRVEGTLQASPPGHLTALQMFNRTYKLYSYSYLGLGLMSARLAILGGVEGKPAENDKELVSPCLSPRFRGEWEHAEVTYRISGQKAVGLYELCASRVSEVLRNKVHRTEEAQHVDFYAFSYYYDLAASFGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPPSSPFACMDLTYISLLLHEFGFPGDKVLKLARKIDNVETSWALGAIFHYIDSLKRQKVPAL |
| Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -81 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.25 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol |
