Active Recombinant Mouse Ifng Protein, His-Tagged

• Cat.No.: Ifng-01M
• Product Overview: Recombinant mouse Ifng Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interferon-γ is a effective multifunctional cytokine which is released mainly by activated NK cells and T cells. IFN-γ is primarily characterized based on its anti-viral activities, and then been proved to have several functions such as anti-proliferative, immune-regulatory, and pro-inflammatory activities. IFN-γ can upregulate expression of MHC class I and II antigen by antigen-presenting cells.
• Form: Lyophilized powder
• AA Sequence: MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIA
  KFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus
• Endotoxin: <0.01 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IFN gamma is approximately >2x 10^6 IU/mg.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Ifng interferon gamma [ Mus musculus (house mouse) ]
• Official Symbol: Ifng
• Synonyms: Ifg; If2f; IFN-g
• Gene ID: 15978
• mRNA Refseq: NM_008337.4
• Protein Refseq: NP_032363.1
• UniProt ID: P01580