Species : |
Mouse |
Source : |
E.coli |
Description : |
Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression |
Bio-activity : |
Determined by its ability to activate STAT following receptor-ligand interaction. |
Molecular Mass : |
19.8 kDa |
AA Sequence : |
MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV |
Endotoxin : |
Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : |
>95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : |
Store at -80 centigrade. |
Storage Buffer : |
Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : |
Resuspend the protein in the desired concentration in proper buffer. |