Active Recombinant Mouse Ifnl2 Protein
Cat.No. : | Ifnl2-145M |
Product Overview : | Purified recombinant protein of Mouse interleukin 28A (Il28a) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression |
Bio-activity : | Determined by its ability to activate STAT following receptor-ligand interaction. |
Molecular Mass : | 19.8 kDa |
AA Sequence : | MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ifnl2 interferon lambda 2 [ Mus musculus (house mouse) ] |
Official Symbol | Ifnl2 |
Synonyms | Ifnl2; interferon lambda 2; Il28a; IL-28A; EG330496; interferon lambda-2; IFN-lambda-2; IFN-lambda2; interferon-lambda2; interleukin-28A |
Gene ID | 330496 |
mRNA Refseq | NM_001024673 |
Protein Refseq | NP_001019844 |
UniProt ID | Q4VK74 |
◆ Recombinant Proteins | ||
Ifnl2-511M | Active Recombinant Mouse Ifnl2 protein, His-tagged | +Inquiry |
Ifnl2-145M | Active Recombinant Mouse Ifnl2 Protein | +Inquiry |
IFNL2-944H | Active Recombinant Human IFNL2 Protein | +Inquiry |
IFNL2-7957H | Recombinant Human IFNL2 | +Inquiry |
IFNL2-121H | Recombinant Active Human IFNL2 Protein, His-tagged(C-ter) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ifnl2 Products
Required fields are marked with *
My Review for All Ifnl2 Products
Required fields are marked with *
0
Inquiry Basket