Active Recombinant Mouse Ifnl3 Protein, His-Tagged
Cat.No. : | Ifnl3-01M |
Product Overview : | Recombinant mouse Ifnl3 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-28 (IL-28) is a cytokine that comes in two isoforms, IL-28A and IL-28B, and plays a role in immune defense against viruses, including the induction of an "antiviral state" by turning on Mx proteins, 2',5'-oligoadenylate synthetase as well as ISGF3G (Interferon Stimulated Gene Factor 3). IL-28A and IL-28B belong to the type III interferon family of cytokines and are highly similar (in amino acid sequence) to IL-29. Their classification as Interferons is due to their ability to induce an antiviral state, while their additional classification as cytokines is due to their chromosomal location as well as the fact that they are encoded by multiple exons, as opposed to a single exon, as most type-I IFNs are. |
Form : | Lyophilized powder |
AA Sequence : | MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSA LTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <20 ng/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Ifnl3 interferon lambda 3 [ Mus musculus (house mouse) ] |
Official Symbol | Ifnl3 |
Synonyms | Il28; IFL-1; Il28b; IL-28B; If1ia2; INF-alpha; INF-lambda |
Gene ID | 338374 |
mRNA Refseq | NM_177396.1 |
Protein Refseq | NP_796370.1 |
UniProt ID | Q4VK73 |
◆ Recombinant Proteins | ||
Ifnl3-1008M | Active Recombinant Mouse Ifnl3 protein, His-tagged | +Inquiry |
IFNL3-112H | Recombinant Human IFNL3, His-tagged | +Inquiry |
Ifnl3-125M | Recombinant Active Mouse IFNL3 Protein, His-tagged(C-ter) | +Inquiry |
IFNL3-3688H | Recombinant Human IFNL3 Protein (Val22-Val196), His tagged | +Inquiry |
IFNL3-60H | Recombinant Human IFNL3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNL3-2059HCL | Recombinant Human IFNL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifnl3 Products
Required fields are marked with *
My Review for All Ifnl3 Products
Required fields are marked with *
0
Inquiry Basket