Active Recombinant Mouse IL11 Protein
Cat.No. : | IL11-131M |
Product Overview : | Recombinant Mouse IL11 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Interleukin 11 (IL-11) is a member of the gp130 family of cytokines. IL-11 functions to promote hematopoietic stem cell proliferation and megakaryocyte differentiation. In non-hematopoietic cell populations, IL-11 stimulates acute-phase proteins, modulates the development of immunoglobulin-producing B cells, and regulates bone turnover. IL-11 binds the IL-11Rα receptor to activate JAK downstream signaling. |
Bio-activity : | B9 cell proliferation, ED50≤250 ng/mL |
Molecular Mass : | Monomer, 19.3 kDa (179 aa) |
AA Sequence : | MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Il11 interleukin 11 [ Mus musculus (house mouse) ] |
Official Symbol | IL11 |
Synonyms | IL11; interleukin 11; interleukin-11; IL-11; |
Gene ID | 16156 |
mRNA Refseq | NM_008350 |
Protein Refseq | NP_032376 |
UniProt ID | P47873 |
◆ Recombinant Proteins | ||
IL11-953H | Active Recombinant Human IL11 Protein | +Inquiry |
IL11-503H | Recombinant Human IL11 protein, His-tagged | +Inquiry |
Il11-586M | Recombinant Mouse interleukin 11 | +Inquiry |
Il11-1375R | Recombinant Rat Il11 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
Il11-46M | Active Recombinant Mouse Il11 Protein (Pro22-Leu199), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL11 Products
Required fields are marked with *
My Review for All IL11 Products
Required fields are marked with *
0
Inquiry Basket