Active Recombinant Mouse Il4 Protein

• Cat.No.: Il4-109M
• Product Overview: Purified recombinant protein of Mouse interleukin 4 (Il4), transcript variant 1 without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4.
• Bio-activity: The ED50 was determined by the dose-dependent proliferation of murine HT-2 cells is > 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg.
• Molecular Mass: 13.5 kDa
• AA Sequence: MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.
• Publications:
  IFN-γ Limits Immunopathogenesis but Delays Fungal Clearance during Pneumocystis Pneumonia (2023)

Gene Information

• Gene Name: Il4 interleukin 4 [ Mus musculus (house mouse) ]
• Official Symbol: Il4
• Synonyms: Il4; interleukin 4; Il-4; BSF-1; interleukin-4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; IGG1 induction factor; lymphocyte stimulatory factor 1
• Gene ID: 16189
• mRNA Refseq: NM_021283
• Protein Refseq: NP_067258
• UniProt ID: P07750