Active Recombinant Mouse Ldha Protein, His-tagged
Cat.No. : | Ldha-7252M |
Product Overview : | Recombinant Mouse Ldha Protein with a His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Tag : | His |
Protein Length : | 1-332 |
Description : | The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to hemolytic anemia and early postimplantation death in mice. Multiple transcript variants encoding different isoforms have been found for this gene. The mouse genome contains multiple pseudogenes of this gene. |
Form : | Liquid |
Bio-activity : | Specific activity is > 250 units/mg, and is defined as the Amount of enzyme that convert 1.0 μmole of pyruvate to L-lactate and per minute at pH 7.5 at 37 centigrade. |
Molecular Mass : | 37.5 kDa |
AA Sequence : | MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQFLEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Ldha lactate dehydrogenase A [ Mus musculus (house mouse) ] |
Official Symbol | Ldha |
Synonyms | Ldha; lactate dehydrogenase A; l7; LDH; Ldh-; Ldh1; Ldhm; l7R2; L-lactate dehydrogenase A chain; LDH muscle subunit; LDH-M; M-LDH; lactate dehydrogenase 1, A chain; lactate dehydrogenase A4; EC 1.1.1.27 |
Gene ID | 16828 |
mRNA Refseq | NM_001136069 |
Protein Refseq | NP_001129541 |
UniProt ID | Q564E2 |
◆ Recombinant Proteins | ||
LDHA-30120H | Recombinant Human LDHA protein, GST-tagged | +Inquiry |
LDHA-1284H | Recombinant Human LDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
LDHA-0135H | Recombinant Human LDHA Protein (A2-F332), Tag Free | +Inquiry |
LDHA-6836C | Recombinant Chicken LDHA | +Inquiry |
Ldha-1131R | Active Recombinant Rat LDHA protein(Met1-Phe332), His-tagged | +Inquiry |
◆ Native Proteins | ||
LDHA-8315C | Native Chicken LDHA | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDHA-26867TH | Native Human LDHA | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHA-4790HCL | Recombinant Human LDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ldha Products
Required fields are marked with *
My Review for All Ldha Products
Required fields are marked with *