Active Recombinant Mouse Ldha Protein, His-tagged

Cat.No. : Ldha-7252M
Product Overview : Recombinant Mouse Ldha Protein with a His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Tag : His
Protein Length : 1-332
Description : The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to hemolytic anemia and early postimplantation death in mice. Multiple transcript variants encoding different isoforms have been found for this gene. The mouse genome contains multiple pseudogenes of this gene.
Form : Liquid
Bio-activity : Specific activity is > 250 units/mg, and is defined as the Amount of enzyme that convert 1.0 μmole of pyruvate to L-lactate and per minute at pH 7.5 at 37 centigrade.
Molecular Mass : 37.5 kDa
AA Sequence : MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQFLEHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Ldha lactate dehydrogenase A [ Mus musculus (house mouse) ]
Official Symbol Ldha
Synonyms Ldha; lactate dehydrogenase A; l7; LDH; Ldh-; Ldh1; Ldhm; l7R2; L-lactate dehydrogenase A chain; LDH muscle subunit; LDH-M; M-LDH; lactate dehydrogenase 1, A chain; lactate dehydrogenase A4; EC 1.1.1.27
Gene ID 16828
mRNA Refseq NM_001136069
Protein Refseq NP_001129541
UniProt ID Q564E2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ldha Products

Required fields are marked with *

My Review for All Ldha Products

Required fields are marked with *

0
cart-icon
0
compare icon