Active Recombinant Mouse Lgals2 Protein, His-tagged

• Cat.No.: Lgals2-7140M
• Product Overview: Recombinant Mouse Lgals2 protein with a His tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-130
• Description: This protein binds beta-galactoside. Its physiological function is not yet known.
• Form: Liquid
• Bio-activity: The ED50 for this effect is equal or higher than 20 μg/mL. Measured by its ability to agglutinate human red blood cells.
• Molecular Mass: 17.3 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 10 % glycerol,1 mM DTT.

Gene Information

• Gene Name: Lgals2 lectin, galactose-binding, soluble 2 [ Mus musculus (house mouse) ]
• Official Symbol: Lgals2
• Synonyms: Lgals2; lectin, galactose-binding, soluble 2; AI324147; 2200008F12Rik; galectin-2; gal-2
• Gene ID: 107753
• mRNA Refseq: NM_025622
• Protein Refseq: NP_079898
• UniProt ID: Q9CQW5