Active Recombinant Mouse Lgals2 Protein, His-tagged
| Cat.No. : | Lgals2-7140M |
| Product Overview : | Recombinant Mouse Lgals2 protein with a His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-130 |
| Description : | This protein binds beta-galactoside. Its physiological function is not yet known. |
| Form : | Liquid |
| Bio-activity : | The ED50 for this effect is equal or higher than 20 μg/mL. Measured by its ability to agglutinate human red blood cells. |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE |
| Purity : | > 95 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by bradford assay) |
| Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 10 % glycerol,1 mM DTT. |
| Gene Name | Lgals2 lectin, galactose-binding, soluble 2 [ Mus musculus (house mouse) ] |
| Official Symbol | Lgals2 |
| Synonyms | Lgals2; lectin, galactose-binding, soluble 2; AI324147; 2200008F12Rik; galectin-2; gal-2 |
| Gene ID | 107753 |
| mRNA Refseq | NM_025622 |
| Protein Refseq | NP_079898 |
| UniProt ID | Q9CQW5 |
| ◆ Recombinant Proteins | ||
| Lgals2-345M | Recombinant Mouse Lgals2 Protein, MYC/DDK-tagged | +Inquiry |
| Lgals2-7140M | Active Recombinant Mouse Lgals2 Protein, His-tagged | +Inquiry |
| Lgals2-189M | Active Recombinant Mouse Lgals2 protein, His-tagged | +Inquiry |
| LGALS2-3042R | Recombinant Rat LGALS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Lgals2-407R | Active Recombinant Rat Lgals2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LGALS2-4767HCL | Recombinant Human LGALS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lgals2 Products
Required fields are marked with *
My Review for All Lgals2 Products
Required fields are marked with *
