Active Recombinant Mouse Lgals2 Protein, His-tagged

Cat.No. : Lgals2-7140M
Product Overview : Recombinant Mouse Lgals2 protein with a His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-130
Description : This protein binds beta-galactoside. Its physiological function is not yet known.
Form : Liquid
Bio-activity : The ED50 for this effect is equal or higher than 20 μg/mL. Measured by its ability to agglutinate human red blood cells.
Molecular Mass : 17.3 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 0.1 M NaCl, 10 % glycerol,1 mM DTT.
Gene Name Lgals2 lectin, galactose-binding, soluble 2 [ Mus musculus (house mouse) ]
Official Symbol Lgals2
Synonyms Lgals2; lectin, galactose-binding, soluble 2; AI324147; 2200008F12Rik; galectin-2; gal-2
Gene ID 107753
mRNA Refseq NM_025622
Protein Refseq NP_079898
UniProt ID Q9CQW5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lgals2 Products

Required fields are marked with *

My Review for All Lgals2 Products

Required fields are marked with *

0
cart-icon
0
compare icon