Active Recombinant Mouse Pgf Protein
Cat.No. : | Pgf-7301M |
Product Overview : | Mouse recombinant Placenta Growth Factor, aa. 135 / 132 without tag was expressed in insects cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Description : | Broad expression in genital fat pad adult (RPKM 7.3), placenta adult (RPKM 3.2) and 15 other tissues. |
Form : | Lyophilized |
Bio-activity : | Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/mL. |
Molecular Mass : | ~ 40 kDa |
AA Sequence : | ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNQTEEPHP |
N-terminal Sequence Analysis : | ALSAGNNSTE and AGNNSTE |
Endotoxin : | < 0.1 ng/μg of PIGF |
Purity : | > 95 % by SDS-PAGE and Silver staining |
Stability : | Shelf life: one year from despatch. |
Storage : | Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term. After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term. Avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris, 75 mM NaCl, pH 8.5 |
Reconstitution : | PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50 mM Acetic Acid or PBS/water. This solution can be diluted into other buffered solutions. |
Gene Name | Pgf placental growth factor [ Mus musculus (house mouse) ] |
Official Symbol | Pgf |
Synonyms | Pgf; placental growth factor; PI; PL; PIGF; Plgf; AI854365; placenta growth factor |
Gene ID | 18654 |
mRNA Refseq | NM_001271705 |
Protein Refseq | NP_001258634 |
UniProt ID | Q544A5 |
◆ Recombinant Proteins | ||
PGF-382R | Active Recombinant Rhesus macaque PGF protein, His-tagged | +Inquiry |
PGF-484M | Recombinant Mouse Pgf, DDDDK tagged | +Inquiry |
Pgf-1187M | Recombinant Mouse Pgf Protein, His-tagged | +Inquiry |
PGF-101H | Active Recombinant Human PGF Protein | +Inquiry |
PGF-4065R | Recombinant Rat PGF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PGF-21HFL | Active Recombinant Human PGF Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pgf Products
Required fields are marked with *
My Review for All Pgf Products
Required fields are marked with *