Active Recombinant Mouse Pgf Protein

• Cat.No.: Pgf-7301M
• Product Overview: Mouse recombinant Placenta Growth Factor, aa. 135 / 132 without tag was expressed in insects cell.

Specification

• Species: Mouse
• Source: Insect Cells
• Description: Broad expression in genital fat pad adult (RPKM 7.3), placenta adult (RPKM 3.2) and 15 other tissues.
• Form: Lyophilized
• Bio-activity: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/mL.
• Molecular Mass: ~ 40 kDa
• AA Sequence: ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNQTEEPHP
• N-terminal Sequence Analysis: ALSAGNNSTE and AGNNSTE
• Endotoxin: < 0.1 ng/μg of PIGF
• Purity: > 95 % by SDS-PAGE and Silver staining
• Stability: Shelf life: one year from despatch.
• Storage: Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term.
  After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term.
  Avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris, 75 mM NaCl, pH 8.5
• Reconstitution: PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50 mM Acetic Acid or PBS/water. This solution can be diluted into other buffered solutions.

Gene Information

• Gene Name: Pgf placental growth factor [ Mus musculus (house mouse) ]
• Official Symbol: Pgf
• Synonyms: Pgf; placental growth factor; PI; PL; PIGF; Plgf; AI854365; placenta growth factor
• Gene ID: 18654
• mRNA Refseq: NM_001271705
• Protein Refseq: NP_001258634
• UniProt ID: Q544A5