Active Recombinant Mouse Pgf Protein

Cat.No. : Pgf-7301M
Product Overview : Mouse recombinant Placenta Growth Factor, aa. 135 / 132 without tag was expressed in insects cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Description : Broad expression in genital fat pad adult (RPKM 7.3), placenta adult (RPKM 3.2) and 15 other tissues.
Form : Lyophilized
Bio-activity : Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/mL.
Molecular Mass : ~ 40 kDa
AA Sequence : ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNQTEEPHP
N-terminal Sequence Analysis : ALSAGNNSTE and AGNNSTE
Endotoxin : < 0.1 ng/μg of PIGF
Purity : > 95 % by SDS-PAGE and Silver staining
Stability : Shelf life: one year from despatch.
Storage : Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term.
After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term.
Avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris, 75 mM NaCl, pH 8.5
Reconstitution : PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50 mM Acetic Acid or PBS/water. This solution can be diluted into other buffered solutions.
Gene Name Pgf placental growth factor [ Mus musculus (house mouse) ]
Official Symbol Pgf
Synonyms Pgf; placental growth factor; PI; PL; PIGF; Plgf; AI854365; placenta growth factor
Gene ID 18654
mRNA Refseq NM_001271705
Protein Refseq NP_001258634
UniProt ID Q544A5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pgf Products

Required fields are marked with *

My Review for All Pgf Products

Required fields are marked with *

0
cart-icon
0
compare icon