Active Recombinant Mouse Platelet receptor Gi24, His-tagged
Cat.No. : | Gi24-717M |
Product Overview : | The recombinant mouse B7-H5 protein is expressed as a 173 amino acid protein consisting of Phe33 - Ala191 region of B7-H5 (UniProt accession #Q9D659) and and a C-terminal His-tag. It contains 3 potential sites for N-linked glycosylation. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Human Cells |
Tag : | His |
Protein Length : | 33-191 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). |
Bio-activity : | Inhibits anti-CD3e antibody induced IL-2 secretion and T cell proliferation. |
Molecular Mass : | Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition 40-45 kDa probably due to glycosylation |
AA Sequence : | FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAA NTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVY PSSSQDSENITAASTGHHHHHHHH |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition. |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
◆ Recombinant Proteins | ||
Gi24-349H | Active Recombinant Human Gi24 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
Gi24-716M | Active Recombinant Mouse Platelet receptor Gi24, Fc-tagged | +Inquiry |
Gi24-384M | Recombinant Mouse Gi24 Protein, His-tagged | +Inquiry |
Gi24-714M | Active Recombinant Mouse Platelet receptor Gi24, Fc-tagged, Biotinylated | +Inquiry |
Gi24-2936R | Recombinant Rhesus macaque Gi24 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gi24 Products
Required fields are marked with *
My Review for All Gi24 Products
Required fields are marked with *
0
Inquiry Basket