Active Recombinant Mouse Platelet receptor Gi24, His-tagged

Cat.No. : Gi24-717M
Product Overview : The recombinant mouse B7-H5 protein is expressed as a 173 amino acid protein consisting of Phe33 - Ala191 region of B7-H5 (UniProt accession #Q9D659) and and a C-terminal His-tag. It contains 3 potential sites for N-linked glycosylation.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Human Cells
Tag : His
Protein Length : 33-191 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity : Inhibits anti-CD3e antibody induced IL-2 secretion and T cell proliferation.
Molecular Mass : Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition 40-45 kDa probably due to glycosylation
AA Sequence : FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAA NTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVY PSSSQDSENITAASTGHHHHHHHH
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition.
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gi24 Products

Required fields are marked with *

My Review for All Gi24 Products

Required fields are marked with *

0
cart-icon