Active Recombinant Mouse Shh Protein
Cat.No. : | Shh-5862M |
Product Overview : | Purified recombinant protein of Mouse sonic hedgehog (Shh) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN. Both activities occur in the reticulum endoplasmic. Once cleaved, ShhC is degraded in the endoplasmic reticulum. |
Bio-activity : | Determined by its ability to induce alkaline phosphatase production by C3H/10T1/2 (CCL-226) cells. The expected ED50 for this effect is 0.5-1.0μg/mL. |
Molecular Mass : | 20 kDa |
AA Sequence : | IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 90% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Unopened vial can be stored between 2 and 8 centigrade for up to 2 weeks, at -20 centigrade for up to 6 months, or at -70 centigrade or below until the expiration date. Aliquots can be stored between 2 and 8 centigrade for up to one week and stored at -20 centigrade or colder for up to 3 months. Avoid repeated freeze/thaw cycles. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Shh sonic hedgehog [ Mus musculus (house mouse) ] |
Official Symbol | Shh |
Synonyms | SHH; sonic hedgehog; sonic hedgehog protein; HHG-1; short digits; hemimelic extra toes; Hx; Dsh; Hhg1; Hxl3; M100081; 9530036O11Rik |
Gene ID | 20423 |
mRNA Refseq | NM_009170 |
Protein Refseq | NP_033196 |
UniProt ID | Q62226 |
◆ Recombinant Proteins | ||
SHH-30499TH | Recombinant Human SHH | +Inquiry |
SHH-5050R | Recombinant Rat SHH Protein, His (Fc)-Avi-tagged | +Inquiry |
Shh-7339M | Recombinant Mouse Shh Protein, His-tagged | +Inquiry |
Shh-6804M | Recombinant Mouse Shh Protein (Cys25-Gly198) | +Inquiry |
Shh-1856R | Recombinant Rat Shh protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SHH-1533HCL | Recombinant Human SHH cell lysate | +Inquiry |
SHH-1176MCL | Recombinant Mouse SHH cell lysate | +Inquiry |
SHH-1494HCL | Recombinant Human SHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Shh Products
Required fields are marked with *
My Review for All Shh Products
Required fields are marked with *
0
Inquiry Basket