Active Recombinant SARS-CoV2 Envelope Protein, His-tagged

Cat.No. : E-105S
Product Overview : Recombinant envelope (E) protein of the novel coronavirus (SARS-CoV2), a monomeric polypeptide of 86 (75+11) amino acids, with His at C-terminus was expressed in E. coli cells and purified by an affinity column in combination of other chromatograph methods.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : SARS-CoV-2
Source : E.coli
Tag : His
Description : Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined. The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The envelope protein is found in virus particles. This protein facilitates assembly and release of the virus and has ion channel activity required for pathogenesis.
Bio-activity : Recombinant envelope protein of SARS-CoV2 is suitable for the studies of antibody generation and other related function assays.
Molecular Mass : 10 kDa
AA Sequence : MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLVGGGLEHHHHHH*
Purity : ≥ 90%, as determined by SDS-PAGE.
Storage : The protein sample can be stored under sterile conditions at 2-8 centigrade for one month or at -20 to -70 centigrade for three months without detectable loss of activity.
Storage Buffer : Formulation 20 mM Tris-Cl, pH7.9, 20% glycerol, 100 mM NaCl, 1 mM DTT and 0.5 mM EDTA.
Gene Name E envelope protein [ Severe acute respiratory syndrome coronavirus 2 ]
Official Symbol E
Synonyms E; envelope protein; envelope protein; ORF4; structural protein; E protein
Gene ID 43740570
Protein Refseq YP_009724392

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E Products

Required fields are marked with *

My Review for All E Products

Required fields are marked with *

0
cart-icon