Active Recombinant TEV Protease (AA 5-236), N-GFP and C-His-Tagged
| Cat.No. : | Protease-75T |
| Product Overview : | Recombinant TEV Protease (AA 5-236) with N-GFP and C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Tobaco Etch Virus |
| Source : | E.coli |
| Tag : | GFP&His |
| Protein Length : | AA 5-236 |
| Form : | Liquid |
| Bio-activity : | > 0.25 μmol/min/mg (determined by cleavage of labeled peptide (Fluorometric assay), TEV Protease Activity Kit) |
| AA Sequence : | KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE |
| Purity : | > 85% as determined by SDS-PAGE |
| Storage : | Stored at -20 centigrade and shipped on blue ice |
| Storage Buffer : | 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol; pH 8.0 |
| Official Symbol | Protease |
| Synonyms | greenTEV; p1 protease; TEV Protease; TEV; Tobacco Etch Virus nuclear-inclusion-a endopeptidase; rTEV; EC 3.4.22.44 |
| UniProt ID | Q0GDU8 |
| ◆ Recombinant Proteins | ||
| Protease-01 | Active Recombinant Human Protease Protein, 6×His tagged | +Inquiry |
| Protease-308P | Active Recombinant TEV Protease Protein (231 aa), N-His-tagged | +Inquiry |
| Protease-532T | Recombinant TEV protease | +Inquiry |
| CED41 | Active Recombinant Lysobacter Enzymogenes Arg-C, His-tagged | +Inquiry |
| Protease-92 | Active Recombinant Protease | +Inquiry |
| ◆ Native Proteins | ||
| Protease-68T | Recombinant Tobacco etch virus Protease protein | +Inquiry |
| Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Protease Products
Required fields are marked with *
My Review for All Protease Products
Required fields are marked with *
Recently Viewed
