"VRK3" Related Products

Expand

Recombinant Human VRK3 protein, His-tagged

Cat.No.: VRK3-3010H
Product Overview: Recombinant Human VRK3 fused with His tag at C-terminal was expressed in HEK293.
Description: Inactive serine/threonine-protein kinase VRK3 is a 474 amino acids protein that belongs to the protein kinase superfamily, CK1 Ser/Thr protein kinase family and VRK subfamily. It contains a protein kinase domain. VRK3 is widely expressed in human tissues and the protein localizes to the nucleus. VRK3 regulates several transcription factors, nuclear envelope assembly, and chromatin condensation and is also required for cell cycle progression.
Source: HEK293
Species: Human
Tag: His
Form: Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
AA Sequence: MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKW SSTVTSPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSP QKTRQSPQTLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGP QKQKFSLKLDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLP SLGRSLQSALDVSPKHVLSERSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLA GYGFAFRYCPSGKHVAYVEGSRSPHEGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPW TNCLPNTEDIMKQKQKLPWDSFVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at< -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name: VRK3 vaccinia related kinase 3 [ Homo sapiens ]
Official Symbol: VRK3
Synonyms: VRK3; vaccinia related kinase 3; inactive serine/threonine-protein kinase VRK3; vaccinia-related kinase 3; serine/threonine-protein kinase VRK3; serine/threonine-protein pseudokinase VRK3;
Gene ID: 51231
mRNA Refseq: NM_001025778
Protein Refseq: NP_001020949
MIM:
UniProt ID: Q8IV63
Chromosome Location: 19q13.33
Function: ATP binding; nucleotide binding; protein kinase activity; protein phosphatase binding; transferase activity, transferring phosphorus-containing groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.