Recombinant Human Anterior Gradient Homolog 3 (Xenopus laevis), His-tagged AGR3-4959H

Recombinant Human Anterior Gradient Homolog 3 (Xenopus laevis), His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Anterior Gradient Homolog 3 (Xenopus laevis), His-tagged

Recombinant Human Anterior Gradient Homolog 3 (Xenopus laevis), His-tagged

AGR3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : AGR3-4959H
Product Overview : AGR3, also known asanterior gradient protein 3 homolog precursor, is a secreted cytoplasmicprotein which is involved in metastasis induction and p53 tumour supressorinhibition. It may serve as molecular marker and potential therapeutic targetfor hormone-responsive breast tumours.
Description : Pleiotrophin andMidkine are structurally related heparin-binding neurotrophic factors, whoseexpression is developmentally regulated. The expression pattern of theseneurotrophic factors suggests function in neurogenesis, cell migration,secondary organogenetic induction, and mesoderm epithelial interaction. Theexpression of PTN increases during the process of brain embryogenesis andreaches maximum levels at time of birth. The physiological roles of PTN andMidkine are largely unknown, but these neurotrophins have been implicated inthe pathogenesis of neuroblastomas.
Concentration : 1 mg/ml
Source : Human
Host : E. coli
Form : Supplied as a liquidin 20 mM Tris-HCl buffer, pH 8.0, containing 20% glycerol, 0.1 M NaCl and 1 mMDTT.
Purity : > 90% pure by SDS-PAGE
Sequence : 22-166 amino acids:MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Molecular Mass : 19.5 kDa (169 aa),confirmed by MALDI-TOF.
Applications : SDS-PAGE
Storage : Store at 4 deg C forshort term storage (1/2 weeks). Aliquot and store at -20 deg C or -70 deg Cfor long term storage. Avoid repeated freeze/thaw cycles.
OfficialSymbol : AGR3
Gene Name : AGR3 anterior gradient homolog3 (Xenopus laevis) [ Homo sapiens ]
Synonyms : AGR3; anteriorgradient homolog 3 (Xenopus laevis); HAG3; hAG-3; BCMP11; PDIA18; anteriorgradient protein 3 homolog; anterior gradient protein 3 homolog; AG-3;OTTHUMP00000158512; OTTHUMP00000201702; OTTHUMP00000201703; breast cancermembrane protein 11; protein disulfide isomerase family A, member 18; breastcancer membrane protein 11; AG3; Anterior gradient protein 3 homolog
Gene ID : 155465
mRNA Refseq : NM_176813
Protein Refseq : NP_789783
MIM : 609482
UniProt ID : Q8TD06
Chromosome Location : 7p21.1
Function : alpha-dystroglycanbinding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy