Recombinant Human Anterior Gradient Homolog 3 (Xenopus laevis), His-tagged
| Cat.No. : | AGR3-4959H |
| Product Overview : | AGR3, also known asanterior gradient protein 3 homolog precursor, is a secreted cytoplasmicprotein which is involved in metastasis induction and p53 tumour supressorinhibition. It may serve as molecular marker and potential therapeutic targetfor hormone-responsive breast tumours. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human |
| Tag : | His |
| Description : | Pleiotrophin andMidkine are structurally related heparin-binding neurotrophic factors, whoseexpression is developmentally regulated. The expression pattern of theseneurotrophic factors suggests function in neurogenesis, cell migration,secondary organogenetic induction, and mesoderm epithelial interaction. Theexpression of PTN increases during the process of brain embryogenesis andreaches maximum levels at time of birth. The physiological roles of PTN andMidkine are largely unknown, but these neurotrophins have been implicated inthe pathogenesis of neuroblastomas. |
| Concentration : | 1 mg/ml |
| Form : | Supplied as a liquidin 20 mM Tris-HCl buffer, pH 8.0, containing 20% glycerol, 0.1 M NaCl and 1 mMDTT. |
| Purity : | > 90% pure by SDS-PAGE |
| Sequence : | 22-166 amino acids:MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL |
| Molecular Mass : | 19.5 kDa (169 aa),confirmed by MALDI-TOF. |
| Applications : | SDS-PAGE |
| Storage : | Store at 4 deg C forshort term storage (1/2 weeks). Aliquot and store at -20 deg C or -70 deg Cfor long term storage. Avoid repeated freeze/thaw cycles. |
| OfficialSymbol : | AGR3 |
| Gene Name | AGR3 anterior gradient homolog3 (Xenopus laevis) [ Homo sapiens ] |
| Synonyms | AGR3; anteriorgradient homolog 3 (Xenopus laevis); HAG3; hAG-3; BCMP11; PDIA18; anteriorgradient protein 3 homolog; anterior gradient protein 3 homolog; AG-3;OTTHUMP00000158512; OTTHUMP00000201702; OTTHUMP00000201703; breast cancermembrane protein 11; protein disulfide isomerase family A, member 18; breastcancer membrane protein 11; AG3; Anterior gradient protein 3 homolog |
| Gene ID | 155465 |
| mRNA Refseq | NM_176813 |
| Protein Refseq | NP_789783 |
| MIM | 609482 |
| UniProt ID | Q8TD06 |
| Chromosome Location | 7p21.1 |
| Function | alpha-dystroglycanbinding |
| ◆ Recombinant Proteins | ||
| AGR3-165H | Recombinant Human AGR3 Protein, HIS-tagged | +Inquiry |
| AGR3-395M | Recombinant Mouse AGR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AGR3-518H | Recombinant Human AGR3 Protein, MYC/DDK-tagged | +Inquiry |
| AGR3-533H | Recombinant Human AGR3 Protein, His-tagged | +Inquiry |
| AGR3-4959H | Recombinant Human Anterior Gradient Homolog 3 (Xenopus laevis), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGR3-8971HCL | Recombinant Human AGR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGR3 Products
Required fields are marked with *
My Review for All AGR3 Products
Required fields are marked with *
