Recombinant Human Ethylmalonic Encephalopathy 1, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Ethylmalonic Encephalopathy 1, His-tagged

Recombinant Human Ethylmalonic Encephalopathy 1, His-tagged

ETHE1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : ETHE1-1382H
Product Overview : Recombinant human ETHE1protein, fused to His-tag at N-terminus, wasexpressed in E.coli and purified by conventional chromatography.
Description : ETHE1 is amitochondrial sulfur dioxygenase involved in catabolism of sulfide thataccumulates to toxic levels in ethylmalonic encephalopathy. Mutations ofETHE1 were detected in all the typical ethylmalonic encephalopathy patientsanalysed, but no ETHE1 mutations were identified in patients presenting withearly onset progressive encephalopathy with ethylmalonic aciduria.Recombinant human ETHE1 protein, fused to His-tag at N-terminus, wasexpressed in E.coli and purified by using conventional chromatography.
Form : Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl.
Molecular Weight : 29.1 kDa (267aa)
Purity : > 90% by SDS–PAGE
Concentration : 1.0 mg/ml(determined by Bradford assay)
Sequences of aminoacids : MGSSHHHHHH SSGLVPRGSHMGSHMLSQRGGSGAPILLRQ MFEPVSCTFT YLLGDRESRE AVLIDPVLET APRDAQLIKE LGLRLLYAVN THCHADHITGSGLLRSLLPG CQSVISRLSG AQADLHIEDG DSIRFGRFAL ETRASPGHTP GCVTFVLNDH SMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPG DCLIYPAHDY HGFTVSTVEE ERTLNPRLTL SCEEFVKIMG NLNLPKPQQI DFAVPANMRCGVQTPTA
Storage : Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name : ETHE1 ethylmalonicencephalopathy 1 [ Homo sapiens ]
Official Symbol : ETHE1
Synonyms : ETHE1;ethylmalonic encephalopathy 1; HSCO; YF13H12; protein ETHE1, mitochondrial;ethylmalonic encephalopathy protein 1; hepatoma subtracted clone one protein
Gene ID : 23474
mRNA Refseq : NM_014297
Protein Refseq : NP_055112
MIM : 608451
UniProt ID : O95571
Chromosome Location : 19q13.32
Function : hydrolase activity;metal ion binding
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2021 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy