"ETHE1" Related Products

Expand
Expand

Recombinant Human Ethylmalonic Encephalopathy 1, His-tagged

Cat. No.: ETHE1-1382H
Product Overview: Recombinant human ETHE1protein, fused to His-tag at N-terminus, wasexpressed in E.coli and purified by conventional chromatography.
Description: ETHE1 is amitochondrial sulfur dioxygenase involved in catabolism of sulfide thataccumulates to toxic levels in ethylmalonic encephalopathy. Mutations ofETHE1 were detected in all the typical ethylmalonic encephalopathy patientsanalysed, but no ETHE1 mutations were identified in patients presenting withearly onset progressive encephalopathy with ethylmalonic aciduria.Recombinant human ETHE1 protein, fused to His-tag at N-terminus, wasexpressed in E.coli and purified by using conventional chromatography.
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl.
Molecular Weight: 29.1 kDa (267aa)
Purity: > 90% by SDS–PAGE
Concentration: 1.0 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHH SSGLVPRGSHMGSHMLSQRGGSGAPILLRQ MFEPVSCTFT YLLGDRESRE AVLIDPVLET APRDAQLIKE LGLRLLYAVN THCHADHITGSGLLRSLLPG CQSVISRLSG AQADLHIEDG DSIRFGRFAL ETRASPGHTP GCVTFVLNDH SMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPG DCLIYPAHDY HGFTVSTVEE ERTLNPRLTL SCEEFVKIMG NLNLPKPQQI DFAVPANMRCGVQTPTA
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: ETHE1 ethylmalonicencephalopathy 1 [ Homo sapiens ]
Official Symbol: ETHE1
Synonyms: ETHE1;ethylmalonic encephalopathy 1; HSCO; YF13H12; protein ETHE1, mitochondrial;ethylmalonic encephalopathy protein 1; hepatoma subtracted clone one protein
Gene ID: 23474
mRNA Refseq: NM_014297
Protein Refseq: NP_055112
MIM: 608451
UniProt ID: O95571
Chromosome Location: 19q13.32
Function: hydrolase activity;metal ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.