"LRPAP1" Related Products

Expand
Expand
Expand

Recombinant Human Low Density Lipoprotein Receptor-Related Protein Associated Protein 1, His-tagged

Cat. No.: LRPAP1-1384H
Product Overview: Recombinant humanLRPAP1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: LRPAP1,also known as alpha-2-macroglobulin receptor-associated protein, belongs tothe alpha-2-MRAP family. This protein interacts withLRP1/alpha-2-macroglobulin receptor and glycoprotein 330. It is present onthe cell surface forming a complex with the alpha 2 macroglobulin receptorheavy and light chains In complex with the alpha 2 MR or gp330, it may havesome role in the pathogenesis of membrane glomerular nephritis.
Form: Liquid. 20mM Tris-HClbuffer (pH8.0) containing 20% glycerol 1mM DTT.
Molecular Weight: 40.4 kDa(348aa), confirmed by MALDI-TOF.
Purity: > 90%by SDS - PAGE
Concentration: 1.0mg/ml (determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMYSREK NQPKPSPKRE SGEEFRMEKL NQLWEKAQRLHLPPVRLAEL HADLKIQERD ELAWKKLKLD GLDEDGEKEARLIRNLNVIL AKYGLDGKKD ARQVTSNSLS GTQEDGLDDP RLEKLWHKAK TSGKFSGEEL DKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDL SDIKGSVLHS RHTELKEKLR SINQGLDRLR RVSHQGYSTE AEFEEPRVID LWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLE IAHEKLRHAE SVGDGERVSR SREKHALLEG RTKELGYTVK KHLQDLSGRI SRARHNEL
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: LRPAP1 low density lipoproteinreceptor-related protein associated protein 1 [ Homo sapiens ]
Official Symbol: LRPAP1
Synonyms: LRPAP1; low density lipoproteinreceptor-related protein associated protein 1; RAP; MRAP; A2RAP; HBP44;A2MRAP; MGC138272; alpha-2-macroglobulin receptor-associated protein;alpha-2-MRAP; OTTHUMP00000115346; lipoprotein receptor associated protein;alpha-2-macroglobulin receptor-associated protein 1; low density lipoproteinreceptor-related protein-associated protein 1; low densitylipoprotein-related protein-associated protein 1 (alpha-2-macroglobulinreceptor-associated protein 1)
Gene ID: 4043
mRNA Refseq: NM_002337
Protein Refseq: NP_002328
MIM: 104225
UniProt ID: P30533
Chromosome Location: 4p16.3
Pathway: Lissencephaly gene (LIS1) in neuronalmigration and development; Reelin signaling pathway; Signaling eventsmediated by the Hedgehog family
Function: asialoglycoprotein receptor activity;heparin binding; lipase binding; low-density lipoprotein particle receptorbinding; receptor antagonist activity; unfolded protein binding;very-low-density lipoprotein particle receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.