Recombinant Human Low Density Lipoprotein Receptor-Related Protein Associated Protein 1, His-tagged LRPAP1-1384H

Recombinant Human Low Density Lipoprotein Receptor-Related Protein Associated Protein 1, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Low Density Lipoprotein Receptor-Related Protein Associated Protein 1, His-tagged

Recombinant Human Low Density Lipoprotein Receptor-Related Protein Associated Protein 1, His-tagged

LRPAP1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : LRPAP1-1384H
Product Overview : Recombinant humanLRPAP1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description : LRPAP1,also known as alpha-2-macroglobulin receptor-associated protein, belongs tothe alpha-2-MRAP family. This protein interacts withLRP1/alpha-2-macroglobulin receptor and glycoprotein 330. It is present onthe cell surface forming a complex with the alpha 2 macroglobulin receptorheavy and light chains In complex with the alpha 2 MR or gp330, it may havesome role in the pathogenesis of membrane glomerular nephritis.
Form : Liquid. 20mM Tris-HClbuffer (pH8.0) containing 20% glycerol 1mM DTT.
Molecular Weight : 40.4 kDa(348aa), confirmed by MALDI-TOF.
Purity : > 90%by SDS - PAGE
Concentration : 1.0mg/ml (determined by Bradford assay)
Sequences of aminoacids : MGSSHHHHHHSSGLVPRGSH MGSHMYSREK NQPKPSPKRE SGEEFRMEKL NQLWEKAQRLHLPPVRLAEL HADLKIQERD ELAWKKLKLD GLDEDGEKEARLIRNLNVIL AKYGLDGKKD ARQVTSNSLS GTQEDGLDDP RLEKLWHKAK TSGKFSGEEL DKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDL SDIKGSVLHS RHTELKEKLR SINQGLDRLR RVSHQGYSTE AEFEEPRVID LWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLE IAHEKLRHAE SVGDGERVSR SREKHALLEG RTKELGYTVK KHLQDLSGRI SRARHNEL
Storage : Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
PDB rendering based on 1lre. :

Gene Name : LRPAP1 low density lipoproteinreceptor-related protein associated protein 1 [ Homo sapiens ]
Official Symbol : LRPAP1
Synonyms : LRPAP1; low density lipoproteinreceptor-related protein associated protein 1; RAP; MRAP; A2RAP; HBP44;A2MRAP; MGC138272; alpha-2-macroglobulin receptor-associated protein;alpha-2-MRAP; OTTHUMP00000115346; lipoprotein receptor associated protein;alpha-2-macroglobulin receptor-associated protein 1; low density lipoproteinreceptor-related protein-associated protein 1; low densitylipoprotein-related protein-associated protein 1 (alpha-2-macroglobulinreceptor-associated protein 1)
Gene ID : 4043
mRNA Refseq : NM_002337
Protein Refseq : NP_002328
MIM : 104225
UniProt ID : P30533
Chromosome Location : 4p16.3
Pathway : Lissencephaly gene (LIS1) in neuronalmigration and development; Reelin signaling pathway; Signaling eventsmediated by the Hedgehog family
Function : asialoglycoprotein receptor activity;heparin binding; lipase binding; low-density lipoprotein particle receptorbinding; receptor antagonist activity; unfolded protein binding;very-low-density lipoprotein particle receptor binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy