"PAPSS1" Related Products

Expand

Recombinant Human 3'-Phosphoadenosine 5'-Phosphosulfate Synthase 1, His-tagged

Cat. No.: PAPSS1-1390H
Product Overview: Recombinant humanPAPSS1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: PAPSS1, also knownas bifunctional 3"-phosphoadenosine 5"-phosphosulfate synthase 1, is abifunctional enzyme with both ATP sulfurylase and APS kinase activity, whichmediates two steps in the sulfate activation pathway, yielding3"-phosphoadenylylsulfate (PAPS).
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl.
Molecular Weight: 70.9 kDa(626aa)
Purity: > 85%by SDS - PAGE
Concentration: 0.5mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMRATNV TYQAHHVSRN KRGQVVGTRG GFRGCTVWLTGLSGAGKTTV SMALEEYLVC HGIPCYTLDG DNIRQGLNKN LGFSPEDREE NVRRIAEVAK LFADAGLVCITSFISPYTQD RNNARQIHEG ASLPFFEVFV DAPLHVCEQR DVKGLYKKAR AGEIKGFTGI DSEYEKPEAPELVLKTDSCD VNDCVQQVVE LLQERDIVPV DASYEVKELY VPENKLHLAK TDAETLPALK INKVDMQWVQVLAEGWATPL NGFMREREYL QCLHFDCLLD GGVINLSVPI VLTATHEDKE RLDGCTAFAL MYEGRRVAILRNPEFFEHRK EERCARQWGT TCKNHPYIKM VMEQGDWLIG GDLQVLDRVY WNDGLDQYRLTPTELKQKFKDMNADAVFAF QLRNPVHNGH ALLMQDTHKQ LLERGYRRPV LLLHPLGGWT KDDDVPLMWR MKQHAAVLEEGVLNPETTVV AIFPSPMMYA GPTEVQWHCR ARMVAGANFY IVGRDPAGMP HPETGKDLYE PSHGAKVLTMAPGLITLEIV PFRVAAYNKK KKRMDYYDSE HHEDFEFISG TRMRKLAREG QKPPEGFMAP KAWTVLTEYYKSLEKA
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: PAPSS1 3"-phosphoadenosine5"-phosphosulfate synthase 1 [ Homo sapiens ]
Official Symbol: PAPSS1
Synonyms: PAPSS1; 3"-phosphoadenosine5"-phosphosulfate synthase 1; asSK1; PAPSS; ATPSK1; bifunctional3"-phosphoadenosine 5"-phosphosulfate synthase 1; SK 1; PAPSS 1; PAPS synthase1; OTTHUMP00000161864; sulfurylase kinase 1; 3-prime-phosphoadenosine5-prime-phosphosulfate synthase 1; EC 2.7.1.25; EC 2.7.7.4
Gene ID: 9061
mRNA Refseq: NM_005443
Protein Refseq: NP_005434
MIM: 603262
UniProt ID: O43252
Chromosome Location: 4q24
Pathway: Biologicaloxidations; Cytosolic sulfonation of small molecules; Formation of PAPS;Metabolic pathways; Phase II conjugation; Purine metabolism; Selenocompoundmetabolism; Sulfur metabolism
Function: ATPbinding; adenylylsulfate kinase activity; nucleotide binding; nucleotidyltransferaseactivity; sulfate adenylyltransferase (ATP) activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.