Recombinant Human 3'-Phosphoadenosine 5'-Phosphosulfate Synthase 1, His-tagged PAPSS1-1390H

Recombinant Human 3'-Phosphoadenosine 5'-Phosphosulfate Synthase 1, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human 3'-Phosphoadenosine 5'-Phosphosulfate Synthase 1, His-tagged

Recombinant Human 3'-Phosphoadenosine 5'-Phosphosulfate Synthase 1, His-tagged

PAPSS1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : PAPSS1-1390H
Product Overview : Recombinant humanPAPSS1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description : PAPSS1, also knownas bifunctional 3"-phosphoadenosine 5"-phosphosulfate synthase 1, is abifunctional enzyme with both ATP sulfurylase and APS kinase activity, whichmediates two steps in the sulfate activation pathway, yielding3"-phosphoadenylylsulfate (PAPS).
Form : Liquid. 20mMTris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl.
Molecular Weight : 70.9 kDa(626aa)
Purity : > 85%by SDS - PAGE
Concentration : 0.5mg/ml(determined by Bradford assay)
Sequences of aminoacids : MGSSHHHHHHSSGLVPRGSH MGSHMRATNV TYQAHHVSRN KRGQVVGTRG GFRGCTVWLTGLSGAGKTTV SMALEEYLVC HGIPCYTLDG DNIRQGLNKN LGFSPEDREE NVRRIAEVAK LFADAGLVCITSFISPYTQD RNNARQIHEG ASLPFFEVFV DAPLHVCEQR DVKGLYKKAR AGEIKGFTGI DSEYEKPEAPELVLKTDSCD VNDCVQQVVE LLQERDIVPV DASYEVKELY VPENKLHLAK TDAETLPALK INKVDMQWVQVLAEGWATPL NGFMREREYL QCLHFDCLLD GGVINLSVPI VLTATHEDKE RLDGCTAFAL MYEGRRVAILRNPEFFEHRK EERCARQWGT TCKNHPYIKM VMEQGDWLIG GDLQVLDRVY WNDGLDQYRLTPTELKQKFKDMNADAVFAF QLRNPVHNGH ALLMQDTHKQ LLERGYRRPV LLLHPLGGWT KDDDVPLMWR MKQHAAVLEEGVLNPETTVV AIFPSPMMYA GPTEVQWHCR ARMVAGANFY IVGRDPAGMP HPETGKDLYE PSHGAKVLTMAPGLITLEIV PFRVAAYNKK KKRMDYYDSE HHEDFEFISG TRMRKLAREG QKPPEGFMAP KAWTVLTEYYKSLEKA
Storage : Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
PDB rendering based on 1x6v. :

Gene Name : PAPSS1 3"-phosphoadenosine5"-phosphosulfate synthase 1 [ Homo sapiens ]
Official Symbol : PAPSS1
Synonyms : PAPSS1; 3"-phosphoadenosine5"-phosphosulfate synthase 1; asSK1; PAPSS; ATPSK1; bifunctional3"-phosphoadenosine 5"-phosphosulfate synthase 1; SK 1; PAPSS 1; PAPS synthase1; OTTHUMP00000161864; sulfurylase kinase 1; 3-prime-phosphoadenosine5-prime-phosphosulfate synthase 1; EC 2.7.1.25; EC 2.7.7.4
Gene ID : 9061
mRNA Refseq : NM_005443
Protein Refseq : NP_005434
MIM : 603262
UniProt ID : O43252
Chromosome Location : 4q24
Pathway : Biologicaloxidations; Cytosolic sulfonation of small molecules; Formation of PAPS;Metabolic pathways; Phase II conjugation; Purine metabolism; Selenocompoundmetabolism; Sulfur metabolism
Function : ATPbinding; adenylylsulfate kinase activity; nucleotide binding; nucleotidyltransferaseactivity; sulfate adenylyltransferase (ATP) activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy