"HAUS1" Related Products

Expand
Expand

Recombinant Human HAUS Augmin-like Complex, Subunit 1, His-tagged

Cat. No.: HAUS1-5580H
Product Overview: Recombinant humanHAUS1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: HAUS1, also known asHAUS augmin-like complex subunit 1, is 1 of 8 subunits of the 390-kDhuman augmin complex, or HAUS complex. HAUS1 wasfirst identified in Drosophila, and its name comes from the Latin verbaugmentare, meaning to increase. HAUS1 is amicrotubule-binding complex involved in microtubule generation within themitotic spindleand is vital to mitotic spindle assembly.
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 50% glycerol, 0.2M NaCl, 2mM DTT.
Molecular Weight: 34.4 kDa (302aa)confirmed by MALDI-TOF
Purity: > 85% by SDS-PAGE
Concentration: 0.25 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMEPQEE RETQVAAWLK KIFGDHPIPQ YEVNPRTTEILHHLSERNRV RDRDVYLVIE DLKQKASEYE EAKYLQDLL MESVNFSPAN LSSTGSRYLN ALVDSAVALETKDTSLASFI PAVNDLTSDL FRTKSKSEEI KIELEKLEKN LTATLVLEKC LQEDVKKAEL HLSTERAKVDNRRQNMDFLK AKSEEFRFGI KAAEEQLSAR GMDASLSHQS LVALSEKLAR LKQQTIPLKKKLESYLDLMPNPSLAQVKIE EAKRELDSIE AELTRRVDMM EL
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
OfficialSymbol: HAUS1
nullValue_other:
FunctionMolecularfunction
Gene Name: HAUS1 HAUS augmin-likecomplex, subunit 1 [ Homo sapiens ]
Synonyms: HAUS1; HAUSaugmin-like complex, subunit 1; HEIC; CCDC5; HEI-C; HsT1461; HAUSaugmin-like complex subunit 1; enhancer of invasion-cluster; coiled-coildomain-containing protein 5; coiled-coil domain containing 5 (spindleassociated); FLJ40084; FLJ21094; OTTHUMP00000163476
Gene ID: 115106
mRNA Refseq: NM_138443
Protein Refseq: NP_612452
MIM: 608775
UniProt ID: Q96CS2
Chromosome Location: 18q21.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.