"LAMA4" Related Products

Expand
Expand

Recombinant Human Laminin α4, GST-tagged

Cat. No.: LAMA4-6953H
Product Overview: Human LAMA4full-length ORF ( AAH04241.1, 1 a.a. - 120 a.a.) recombinant protein withGST-tag at N-terminal.
Description: Laminin subunitalpha-4 is a protein that in humans is encoded by the LAMA4 gene. Laminins, afamily of extracellular matrix glycoproteins, are the major noncollagenousconstituent of basement membranes. They have been implicated in a widevariety of biological processes including cell adhesion, differentiation,migration, signaling, neurite outgrowth and metastasis. Laminins are composedof 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, andB2, respectively) and they form a cruciform structure consisting of 3 shortarms, each formed by a different chain, and a long arm composed of all 3chains. Each laminin chain is a multidomain protein encoded by a distinctgene. Several isoforms of each chain have been described.
Source: wheat germ
MolecularMass: 38.94 kDa
Sequence: MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL
Purity: GlutathioneSepharose 4 Fast Flow
Buffer: 50 mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Format: supplied in 50 mMTris-HCl, 10 mM reduced Glutathione, pH 8.0, and do not contain any known hazardingredient
Quality ControlTesting: 12.5% SDS-PAGEStained with Coomassie Blue.
Applications: Enzyme-linkedImmunoabsorbent Assay; Western Blot (Recombinant protein)
Storage: Store at -80°C.Aliquot to avoid repeated freezing and thawing.
Gene Name: LAMA4 laminin, alpha 4 [ Homosapiens ]
Official Symbol: LAMA4
Synonyms: LAMA4;laminin, alpha 4; LAMA3; LAMA4*-1; DKFZp686D23145; Laminin-14 subunit alpha;Laminin-8 subunit alpha; Laminin-9 subunit alpha
Gene ID: 3910
mRNA Refseq: NM_001105206
Protein Refseq: NP_001098676
MIM: 600133
UniProt ID: Q16363
Chromosome Location: 6q21
Pathway: extracellularmatrix structural constituent; receptor binding
Function: Africantrypanosomiasis; Amoebiasis; ECM-receptor interaction; FOXM1 transcriptionfactor networ; Focal adhesion; Pathways in cancer; Small cell lung cancer;Toxoplasmosis

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.