Recombinant Human TLR4, GST-tagged
| Cat.No. : | TLR4-291H |
| Product Overview : | HumanTLR4 partial ORF (130 aa-201 aa) recombinant protein fused with a GST-tag atN-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 130-201 a.a. |
| Description : | The protein encoded by this gene is a member of the Toll-likereceptor (TLR) family which plays a fundamental role in pathogen recognitionand activation of innate immunity. TLRs are highly conserved from Drosophilato humans and share structural and functional similarities. They recognizepathogen-associated molecular patterns (PAMPs) that are expressed oninfectious agents, and mediate the production of cytokines necessary for thedevelopment of effective immunity. The various TLRs exhibit different patternsof expression. This receptor is most abundantly expressed in placenta, and inmyelomonocytic subpopulation of the leukocytes. It has been implicated insignal transduction events induced by lipopolysaccharide (LPS) found in mostgram-negative bacteria. Mutations in this gene have been associated withdifferences in LPS responsiveness. Also, several transcript variants of thisgene have been found, but the protein coding potential of most of them isuncertain. |
| Form : | 50mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Weight : | 33.55kDa |
| Purification : | GlutathioneSepharose 4 Fast Flow |
| Sequences of aminoacids : | KLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQM |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TLR4 toll-like receptor 4 [ Homo sapiens] |
| Official Symbol | TLR4 |
| Synonyms | TLR4; toll-like receptor 4; TOLL; CD284; TLR-4; ARMD10; toll-like receptor 4; hToll; homolog of Drosophila toll; CD284antigen; OTTHUMP00000022807 |
| Gene ID | 7099 |
| mRNA Refseq | NM_003266 |
| Protein Refseq | NP_003257 |
| MIM | 603030 |
| UniProt ID | O00206 |
| Chromosome Location | 9q33.1 |
| Pathway | Activated TLR4 signalling; Amoebiasis; IKK complex recruitmentmediated by RIP1; Immune System; Influenza A; Innate Immune System; Leishmaniasis;MyD88 cascade initiated on plasma membrane; Pathogenic Escherichia coliinfection; Pertussis; Rheumatoid arthritis; TRAF6 mediated induction of TAK1complex; Toll Like Receptor 10 (TLR10) Cascade; Toll Like Receptor 2 (TLR2)Cascade; Toll Receptor Cascades; Toll-like receptor signaling pathway |
| Function | lipopolysaccharide binding; lipopolysaccharide receptor activity;phosphatidylinositol 3-kinase binding; protein binding; receptor activity; embranesignaling receptor activity |
| ◆ Recombinant Proteins | ||
| TLR4-1674R | Recombinant Rhesus Monkey TLR4 Protein, hIgG1-tagged | +Inquiry |
| Tlr4-7619M | Recombinant Mouse Tlr4 protein, His & S-tagged | +Inquiry |
| TLR4-526HF | Recombinant Full Length Human TLR4 Protein | +Inquiry |
| TLR4-886H | Active Recombinant Human TLR4 Protein, Ser & His-tagged | +Inquiry |
| Tlr4-02M | Active Recombinant Mouse Tlr4 Protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TLR4-402HCL | Recombinant Human TLR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLR4 Products
Required fields are marked with *
My Review for All TLR4 Products
Required fields are marked with *
