"PFKFB3" Related Products

Expand

Recombinant Human PFKFB3, GST-tagged

Cat. No.: PFKFB3-82912TH
ProductOverview: Recombinant human PFKFB3 partial ORF ( 412 a.a. - 520 a.a.) fused with a GST-tag at N-terminal was expressed in wheat germ and purified by Glutathione Sepharose.
Description: PFKM is regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP. Three phosphofructokinase isozymes exist in humans: muscle, liver and platelet. Mutations in this gene have been associated with glycogen storage disease type VII, also known as Tarui disease.
Source: Wheat germ
MolecularMass: 37.73 kDa
AA-Sequence: CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
StorageBuffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Officialsymbol: PFKFB3
Gene Name: PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [ Homo sapiens ]
Synonyms: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3; 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase; Renal carcinoma antigen NY-REN-56; FLJ37326; 6PF-2-K/Fru-2,6-P2ase 3; OTTHUMP00000019041; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; OTTHUMP00000019044; iPFK-2; OTTHUMP00000019048; PFK/FBPase 3; PFK2; IPFK2; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; OTTHUMP00000019052; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; OTTHUMP00000019039; OTTHUMP00000019040; OTTHUMP00000019045; OTTHUMP00000019046; OTTHUMP00000019047; OTTHUMP00000019050
Gene ID: 5209
mRNA Refseq: NM_001145443
Protein Refseq: NP_001138915
MIM: 605319
UniProt ID: Q5VX15
Chromosome Location: 10p15.1
Pathway: AMPK signaling, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem
Function: 6-phosphofructo-2-kinase activity; 6-phosphofructo-2-kinase activity; ATP binding; catalytic activity; fructose-2,6-bisphosphate 2-phosphatase activity; hydrolase activity; identical protein binding; kinase activity; nucleotide binding; protein binding; transferase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.