"PFKFB3" Related Products

Expand

Recombinant Human PFKFB3, GST-tagged

Cat. No.: PFKFB3-82912TH
ProductOverview: Recombinant human PFKFB3 partial ORF ( 412 a.a. - 520 a.a.) fused with a GST-tag at N-terminal was expressed in wheat germ and purified by Glutathione Sepharose.
Description: PFKM is regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP. Three phosphofructokinase isozymes exist in humans: muscle, liver and platelet. Mutations in this gene have been associated with glycogen storage disease type VII, also known as Tarui disease.
Source: Wheat germ
MolecularMass: 37.73 kDa
AA-Sequence: CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
StorageBuffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Officialsymbol: PFKFB3
Gene Name: PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [ Homo sapiens ]
Synonyms: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3; 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase; Renal carcinoma antigen NY-REN-56; FLJ37326; 6PF-2-K/Fru-2,6-P2ase 3; OTTHUMP00000019041; 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme; OTTHUMP00000019044; iPFK-2; OTTHUMP00000019048; PFK/FBPase 3; PFK2; IPFK2; fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase; 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase; OTTHUMP00000019052; inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; OTTHUMP00000019039; OTTHUMP00000019040; OTTHUMP00000019045; OTTHUMP00000019046; OTTHUMP00000019047; OTTHUMP00000019050
Gene ID: 5209
mRNA Refseq: NM_001145443
Protein Refseq: NP_001138915
MIM: 605319
UniProt ID: Q5VX15
Chromosome Location: 10p15.1
Pathway: AMPK signaling, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem
Function: 6-phosphofructo-2-kinase activity; 6-phosphofructo-2-kinase activity; ATP binding; catalytic activity; fructose-2,6-bisphosphate 2-phosphatase activity; hydrolase activity; identical protein binding; kinase activity; nucleotide binding; protein binding; transferase activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.