"CD74" Related Products

Expand
Expand
Expand

Recombinant Human CD74

Cat. No.: CD74-2229H
Product Overview: Recombinant Human CD74 encoding full-length Human CD74was expressed in Wheat germ.
Description: The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
MW (kDa): 18.3
Form: Liquid
Applications: Antibody Production; Functional Study; Compound Screening
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name: CD74 CD74 molecule, major histocompatibility complex, class II invariant chain [ Homo sapiens ]
Official Symbol: CD74
Synonyms: CD74 molecule, major histocompatibility complex, class II invariant chain; DHLAG; HLADG; Ia-GAMMA; CD74; HLA class II histocompatibility antigen gamma chain; ii; p33; HLA-DR-gamma; MHC HLA-DR gamma chain; Ia-associated invariant chain; gamma chain of class II antigens; ia antigen-associated invariant chain; HLA-DR antigens-associated invariant chain; CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); CD74 antigen
Gene ID: 972
mRNA Refseq: NM_004355
Protein Refseq: NP_004346
MIM: 142790
UniProt ID: P04233
Chromosome Location: 5q32
Pathway: Antigen processing and presentation
Function: MHC class II protein binding; beta-amyloid binding; cytokine binding; cytokine receptor activity; identical protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.